KEGG   Olea europaea var. sylvestris (wild olive): 111378732Help
Entry
111378732         CDS       T05244                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00020  Citrate cycle (TCA cycle)
oeu00190  Oxidative phosphorylation
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111378732
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111378732
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111378732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 111378732
NCBI-ProteinID: XP_022857733
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MEDGTLHRFRAASTILAAEGYGSRGESGILRNSEGERFMERYAPTAKDLASRDVISRSMT
MEIREGRGVGPLKDHIYLHLNHLPPEDLKVRLPGISETAAIFAGVDVTKEPISVLPTVHY
NMGGIPTNHHGEVVTIKGDYPDAVTRGLLAAGKAACAYVHGANRLGANSLLDSVQGLYKL
RNSNGSHPTSNILLSVEHTADYTKQCCCVLHTGNIRRMCAIETCIFQFVV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgggacgttacacaggttccgtgctgcctcaacaattctggccgcagagggc
tatgggtctaggggtgaaagtggtattcttaggaatagtgaaggtgaaagattcatggaa
cggtatgccccaacagctaaggatcttgcatcaagagatgtgatctcgagatctatgaca
atggagatccgagaagggcgtggtgtaggacccttgaaagatcatatctatcttcactta
aatcacttacctcctgaggacctcaaggtgagacttcctggaatatctgaaactgctgct
atttttgccggtgtcgatgttacaaaagagccaatctctgttttacctactgtccattat
aacatgggtgggatccccacaaatcaccatggagaggtagttaccatcaaaggtgattat
cctgatgcagtgactcgtggactcttagctgctgggaaagctgcctgtgcatatgttcat
ggcgctaatcgacttggtgcaaattcccttcttgattctgttcagggcttgtacaagctt
agaaattcaaatggctcccatcccacctcaaatatcctgttgagtgttgaacatacagcg
gattatacaaagcaatgctgctgtgttttgcacacaggaaacattagaagaatgtgtgca
atagagacatgcattttccagtttgttgtataa

DBGET integrated database retrieval system