KEGG   Olea europaea var. sylvestris (wild olive): 111379668Help
Entry
111379668         CDS       T05244                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00250  Alanine, aspartate and glutamate metabolism
oeu00410  beta-Alanine metabolism
oeu00430  Taurine and hypotaurine metabolism
oeu00650  Butanoate metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Module
oeu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111379668
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111379668
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111379668
   00430 Taurine and hypotaurine metabolism
    111379668
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111379668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 111379668
NCBI-ProteinID: XP_022858859
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MVLSKASSQSDVSIHSTFASRYVRNSLPRFKVPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDGEAAIG
VGTVGSSEAIMLAGLAFKRKWQNKMKALGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPKKAVEMVDENTICVAAILGSTLNGEFEDVKTLNDLLVKKNQETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNIMENCQENAMVLKAGLEK
TGRFNIVSKDNGVPLVAFSLKDSSRHTEFEVSDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVIDIDKVLRDLDTLPARVTEKVAATEEQAQNGGVVKKSDIEVQREIT
TAWMKFVADKKKTNGVC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttctatccaaggcatcctcccaatccgacgtctcgattcactcgacgttcgcttct
cgatacgttcggaattctcttccaagatttaaggttcccgagaattcgattcctaaggaa
gccgcataccaaatcatcaacgatgaacttatgttggatgggaatccaagattgaatctg
gcttcttttgtcacaacatggatggaacctgagtgtgacaagctcatcatggattccatt
aacaagaattatgtcgatatggatgagtaccccgtcaccactgagcttcagaatcgatgc
gttaacatgatcgcacatctttttaacgcgccattgggagatggggaggcggcaattgga
gttggaacagtaggatcatcggaagccattatgcttgcaggcttagcattcaaaagaaaa
tggcaaaacaagatgaaagccctcggtaaaccctgtgacaagcctaacattgtcactggt
gccaatgttcaggtttgttgggaaaaatttgctaggtattttgaagtggaactgaaggag
gttaagctgagagatggctactatgtaatggaccctaagaaagctgtggaaatggtagat
gagaacacaatttgtgttgctgcaatcttgggttctactcttaatggagaatttgaagat
gttaagaccttgaacgaccttttggtgaaaaagaatcaagaaactgggtgggacactcca
attcatgtggatgcagcaagtggtgggttcattgcaccatttctatacccagaacttgaa
tgggattttaggctgccattggtgaagagtattaatgtgagtgggcacaagtatggactt
gtgtatgctgggattggttgggtaatctggaggaacaaggaggacctgcctgaagaactc
atattccacattaactaccttggagctgatcaacccactttcacactcaacttttctaaa
ggttctagtcaagtaattgctcaatactatcaactcattcgcttgggttacgaggggtac
aagaacatcatggaaaattgtcaagaaaatgcaatggtactcaaggccggcctggagaaa
acgggacgctttaacattgtatcaaaggacaatggagtcccattggtggcattctctctc
aaggacagtagccgtcacactgagttcgaggtgtctgacatgctacgtcgatttgggtgg
atcgtcccggcctataccatgccaccagacgcacaacatgtgacagttcttcgagttgtt
atacgcgaagatttttcaaggactttagccgagcgcctcgtcatcgacatcgacaaagtt
ttacgtgatcttgatacgcttccggctagagttaccgagaaagtggctgccactgaagag
caagcccagaatggtggcgtggtgaagaaaagtgacattgaggtacaaagggagatcact
acagcatggatgaaatttgttgctgacaagaagaagactaacggggtgtgttaa

DBGET integrated database retrieval system