KEGG   Olea europaea var. sylvestris (wild olive): 111380184Help
Entry
111380184         CDS       T05244                                 

Definition
(RefSeq) alpha-glucosidase-like isoform X1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00052  Galactose metabolism
oeu00500  Starch and sucrose metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111380184
   00500 Starch and sucrose metabolism
    111380184
Enzymes [BR:oeu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111380184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 111380184
NCBI-ProteinID: XP_022859442
LinkDB All DBs
Position
Unknown
AA seq 932 aa AA seqDB search
MIHQGKLPVNLKQMSTKRLSVHLLQLVLFYLLIFFKLLDSATSANGVLSSSPEEEEEIEA
AIGYGYSIQSVIGDSSGKTLTAHLQLIQNSSILGLDIQFLTLTASFETKDRLRIRITDAD
SPRWEIPQQILPRQSQSPLRRSLVGNHPSPPQNHRLFLSDPTSDLTFTLQNTAPFGFTVS
RISSGDTLFNTTPVNHRPSTYLIFKDQYLQLSSALPPHTSNLYGIGEHTKSSFRLQHNQT
LTLWNADIASAKIDLNLYGSHPFYMDVRSPGGITHGVLLLNSNGMDVVYTGDRITYKVIG
GMLDLYFFSGPGPEMVMEQYTDLIGRPAPMPYWSFGFHQCRYGYEDVYDLENVVAGYSEA
RIPLEVMWTDIDYMDGYKDFTLDPINFPTEKMKKFVNALHQNGQKYVVILDPGISVNETY
PTYTRGMQADIFIKRNGEPYLGKVWPGFTYFPDFLNPSTGVYWGNEIKKFFELLPVDGLW
IDMNEIANFITSLPNPSSTLDNPPYKINNAGIQRLIGEETIPATSLHFSNITEYNAHNLY
GFLESKATNEALVNVTGKRPFVLSRCTFVGSGKYSAHWTGDNAATWSDLAYSIPSILNFG
IFGIPMVGADICGFFGNTTEELCQRWIQLGAFYPFARDHSDKDAIRQELYIWNSVTTTAR
KVLGLRYRLLPYFYTLMYEAHSKGIPIARPIFFSFPQDTNTYNISSQFLLGKGILVSPVL
EPGVVSVDAYFPAGNWFDLFDYSRSVNSQEGSYIKLDAPPDHINVHIREGNILAMQGEAM
TTREARKTPFQLLVAISGRENSSGEVFLDDGEDMEMGGEGGKWSLIKFNSGMVRNRLILR
SEVLNEEFAVNQKWTIDKVTFLGLNESFKKIKGYQLVTGMGVRENRHLDISIKANSNGYV
NVEISNLSILVGKEFVLEITPKKCNKTNACSQ
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcaaggaaagctccctgtaaatctgaagcaaatgagcacaaaaagactatca
gtacatcttctgcagcttgttctcttctatttgttgatcttcttcaaattattggattca
gcaacatctgcaaatggagtattatcatcatcgccagaagaagaagaagaaatagaagca
gcaattggatatggctacagcattcaatctgtgatcggcgattcatccgggaagacgttg
actgctcatcttcagctcatccaaaattcctcgatactcggacttgatattcaattcctc
accctcactgccagcttcgaaacgaaagatcgtttaagaatcagaattacggatgccgac
agtccaagatgggaaatcccacaacaaatcctcccccgccaatctcaatccccactccga
cgttccctcgtgggaaaccacccttcaccacctcaaaaccaccgccttttcctctcagac
cccacctcggacctcactttcaccctccagaatactgccccatttggtttcaccgtcagc
cgcatctcctctggcgataccctcttcaacaccaccccagtaaaccatcgacccagcaca
tacctcatcttcaaagaccagtatctgcaactctcctccgcattgccgccccacacctca
aatctttatggcattggggagcacacaaagagctcgttcaggcttcagcataaccagact
cttaccctgtggaatgccgacattgccagtgccaagattgatctcaacttgtatggatct
caccctttctatatggacgttcggtcccctggtgggatcactcatggagttttgctgctc
aatagtaatggcatggatgttgtgtacactggggataggattacctacaaggtgattggt
ggaatgcttgacttatacttcttctctgggccgggcccagaaatggttatggaacagtac
acggaccttatcggccgccctgcacctatgccttattggtcatttggatttcatcagtgc
cgctatggttacgaagatgtctatgaccttgagaatgtggtagctggttattcagaagct
agaattcctctagaagttatgtggacagatattgattacatggatggctacaaagatttc
actcttgatcccattaattttcccacggagaagatgaagaaatttgtcaatgctcttcac
cagaatggtcagaaatatgtggtcatcctagatcccggcattagcgtaaatgagacgtat
cctacctacacaagaggaatgcaagctgacatcttcataaagcgtaatggtgaaccttac
cttggaaaggtttggcctggatttacctacttccctgactttctgaacccgtccactgga
gtatattggggtaatgaaataaaaaaattcttcgaacttctccctgttgatggcctgtgg
attgacatgaatgagatagccaatttcataacttcacttcccaatccatcttcaactctt
gataatcctccctataagatcaataatgctggaattcaacgtctcattggtgaggaaact
atacctgcaacttcactacattttagcaacattacagagtataacgcgcacaatctctat
ggttttttggaatccaaagctactaatgaagccttagtcaatgtaactggtaaaaggcca
tttgtactaagcagatgtacttttgtgggttctggaaagtactcggctcactggactgga
gacaatgctgccacctggagtgatttggcatactcgatcccaagcatcttgaattttgga
atatttggaattccaatggttggagctgatatatgtggtttttttgggaacacgactgaa
gaactttgccagcgctggattcagctaggggcgttctatcccttcgcaagagaccattct
gacaaggatgccatccgtcaggagctatatatctggaattcagtcactacaacagccagg
aaagtgttaggacttcgttaccgcctattgccttacttctacacattgatgtacgaggca
cactccaaaggcatacctatagcacgaccaattttcttctcatttccccaggatacaaac
acctacaacatcagttcgcagtttctactcggtaaggggattttggtgtcgcccgtacta
gagcctggagtagtttctgtcgatgcgtattttccagcagggaactggttcgacctcttt
gactactcacgttctgtgaattcacaagaaggaagttatatcaagcttgatgcacctcct
gatcatatcaacgtgcatattcgggaaggaaacatattagccatgcaaggagaagcaatg
acaacacgagaagcccggaaaactccgttccaactgttggtggcaattagcggaagagaa
aacagctcaggggaagttttcttggatgatggagaggatatggaaatgggaggtgaagga
ggaaaatggagtttgataaaatttaacagcggtatggtaaggaatagactaatactaaga
tctgaggttttgaatgaagagtttgctgtgaatcagaagtggactatagacaaggtgact
tttctgggattgaacgaaagtttcaagaagattaaaggatatcaattagttactggaatg
ggcgtgagagagaatagacacttggatataagcattaaagccaacagcaatgggtatgtt
aatgtggagatatcgaacctgtcaattctcgtgggtaaagaatttgtgttggagattaca
cccaagaagtgtaacaaaacaaatgcatgctctcagtaa

DBGET integrated database retrieval system