KEGG   Olea europaea var. sylvestris (wild olive): 111383137Help
Entry
111383137         CDS       T05244                                 

Definition
(RefSeq) helicase and polymerase-containing protein TEBICHI-like isoform X1
  KO
K02349  DNA polymerase theta [EC:2.7.7.7]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oeu03400]
    111383137
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     111383137
DNA repair and recombination proteins [BR:oeu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   DNA polymerases
    111383137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_A DEAD Helicase_C HHH_5 ResIII
Motif
Other DBs
NCBI-GeneID: 111383137
NCBI-ProteinID: XP_022862979
LinkDB All DBs
Position
Unknown
AA seq 2184 aa AA seqDB search
MDSGSPRSRIDQFFASKKKRKTLSPPSKSGRPEKEAKIKIEGSPGAGGSLESFLVTSWDG
DLHTKPLNTACDPKAKQAPTKRNLTLEIGLSSKDGNNEANLSSQAHPQSFEAFQEDQRGK
TKVLFDTVDVATRDYQKDSSESKIVAGNSELKQFANDFLSMYCCDVPSTAGVQSEPNVSM
NKRQEEKSSKKKHLRNDGNQSIVEQKVTSSDDKNPVNIQSTVVSESGDVDSKYSQEVIGC
NNPAELQASMRKCRYASALCTTACDTPGSLTMKLGARQTPQTTRRSSIFSPGEEFWNEAI
VVADGLFASKDSVSSHVAENTEAFLAGYEMNKSNNVKNVGSCNALNKALKGDIERISAAG
SLGKHGKDLNKEVSPLPVKHFDFSSEEKQLDKETSSHDNNTIPCTLRDEEKRCASTSHHG
LPNNDGREICCKVQTHKISPGGQGMTTKCAISQRNVEFVIQNSDSFTSDTPEKECSKFSV
NHEPNNNITPSSFSSIKDWLDLSNWLPPEICCIYKKKGILKLYPWQVDCLRVDGVLQNRN
LVYCASTSAGKSFVAEVLMLRRVVSTGKMALLVLPYVSICAEKAEHLEVLLEPLDKHVRS
YYGNQGGGTLPKDTSVAVCTIEKANSLINRLLEEGRLSELGIIVIDELHMVGDQSRGYLL
ELMLTKLRYAAGEGNVESSSGENSSMSSGKSDAAHGLQIVGMSATLPNVAAVADWLQAAL
YQTDFRPVPLEEYIKVGNTIYNKEMELVRTLPKVADLGGKDPDQIVELCNEVVQEGHSVL
IFCSSRKGCESTSRHVAKYLKKFSVCPHDGHSESIDVTFAIDALRRSPAGLDPVLEETLP
LGVAYHHAGLTVEERETVETCYRKGLVRVLTATSTLAAGVNLPARRVIFRQPRIGRDFID
GTRYKQMAGRAGRTGIDTKGESVLICKPEEVKRIFALLNDGCPPLHSCLSDDKNGMTHAI
LEVVAGGIVQSASDINRYVRCTLLNSTKPFEDVVKSAQDSLRWLCHKKFLEWSEETKLYT
TTPLGRASFGSSLSPEESLIVLDDLIRAREGFVLASDLHLVYLVTPINVDVEPDWELYYE
RFMQLPSLDQSVGNRVGVQEHFLMRMAHGAPIRTSHRSRDSSKGLLGRYDHRLGKPTHGM
LSDDQMLRVCRRLYVALILSRLVQEVPVAEVCEAFKVARGMVQALQENAGRFASMVTVFC
ERLSWHDLEGLVAKFQNRVSFGVRAEIVELTTIPYIKGSRARVLYKAGLRTPQAIAEASV
PEIVKVLFETSSWATQSSAQRRIELGVAKKIKNGARKIVLDKAEEARVAAFSAFKSLGLK
VPEFSRPLLSAVSGDAPKKESTNSSGEESTSSFAGLDDSKHVLDALSFKEKRKTGGVISE
TEEGKSTETSTVGLASSVKGNPAGTSLGELVEKPALLEEGVNTLGDGLHSTTQHINDANT
SDVDNKRNESDEHVDNGGQQQPERENMCRGTRGNELEMGPVNATSFPGGFDSFLDLWDAS
GEFYFDIHFTKRSELSSIVPFEIHGMAVCWEDSPVYYLNFPKDLRRCNGRRNDHATEDCK
YVLPPKDQMEIAKERWNRIGIIMGKKDVKKLTWNLKFQIQVLKRPAVSVHRSSSMHAEVK
TLSLDLIENSYYMLSPIHVQNAVDMCIVAWILSPDEEKSSNPSLEKEVKKRLSSDAAAAA
NRNGRWNNQMRRVAHNGCCRRAAQTRALHSVLWKLLVSEELIETLVTTEIPLVNVLADME
ICGIGVDMERCLRARHILRTKLKYLEKEAYQLAGMKFSLSMSADIANILYGHLKLPKPEG
YEGKLHPSTDKHCLDMLRNEHPIVPVIKEHRTLAKLLNSTLGSICSLARLSMRTQKYTLH
GHWLQTSTATGRLSMEEPNLQCVEHMVEFKINNNDKDDDESGSGHYKINARDFFVPTQDD
WLLLTADYSQIELRMMAHFSKDSLLVELLSDPQGDIFAMIAAKWTGKDNCDVTSQERNQT
KRLVYGILYGMGPNTLAEQLDCSSNEAAEKIQTFKKSFPGVASWLEEAVKSCRKKGFIKT
LKGRKRFLTKIKFGNSKEKSKAQRQAVNSICQGSAADIIKIAMINIHSVIVDDAEAFHPS
SVFAEKFYMLKGRCRLLLQVHDELVLETDPSVVKEAGLLLQTCMESAMSLLVPLPVKLKV
GRTWGSLEPFMPEKCNDDVTLPGS
NT seq 6555 nt NT seq  +upstreamnt  +downstreamnt
atggattctggttcgcctcgttctcgcatcgaccagttctttgcttctaaaaagaagagg
aagactttatcaccgccttcgaaatctgggagaccagaaaaagaagcaaaaattaaaatt
gaaggctctcctggtgccggaggttcgttggaaagttttttggtgacttcatgggatgga
gatttgcatactaagcctttgaacactgcttgtgatccaaaggctaagcaggctccaacc
aagagaaatctgactttggagattggcttgtcatctaaagatggaaataacgaggcaaat
ctctcaagccaagcacacccacaaagttttgaagcttttcaagaggatcaaaggggaaaa
actaaagtcttgtttgatactgttgatgttgcaacaagagattatcaaaaggattcatca
gaatccaagattgttgcaggaaactctgagcttaagcagtttgcaaatgattttttgtca
atgtattgctgtgacgtaccatctactgcaggagtacaatcggaaccgaatgtgtccatg
aataaaaggcaggaagagaaatcctcaaagaaaaagcatcttaggaatgatgggaatcag
tctattgtcgagcagaaggtcacttcctcagacgataagaatcctgtcaatattcagtca
actgttgttagtgaatcaggagatgtagattcaaaatattctcaggaggttattgggtgt
aacaatcccgctgaactgcaagcaagtatgagaaaatgccgttatgcatctgctctttgt
acaactgcatgtgacacacctggttcattgactatgaaacttggagctcgtcaaactccc
cagacaacgagacgaagctctatattttccccgggagaagaattttggaatgaggcaatt
gtagtcgctgatggtctctttgcttccaaggacagtgtttcttctcatgtagctgaaaat
actgaagcttttctggcaggttatgagatgaataagtcaaataatgtgaaaaatgttgga
tcttgcaatgcactcaacaaagcattgaaaggagatatagaacgaatttctgctgcaggc
tcactggggaagcatggaaaagatctaaataaagaagtgtcacctttgcctgtcaagcat
tttgacttctcttctgaggaaaaacaattggataaggaaacttcttctcatgataataat
accataccttgcactcttagagatgaagaaaagagatgtgcttctaccagtcatcatggt
ttgccgaacaatgatggtagggaaatttgctgcaaagttcaaacacacaaaatttcacct
ggtggacaagggatgaccactaaatgtgccatttcccagagaaatgtggaatttgtgatt
caaaatagtgacagttttacgtctgatacaccagagaaagaatgcagtaaattttctgtt
aatcatgaacccaataacaatattactccatcaagtttttcttcaattaaggattggtta
gatctcagcaattggctgcctcctgaaatatgctgcatatacaagaaaaaggggatattg
aaattgtatccttggcaggttgactgccttcgggtggatggtgtcttgcagaacaggaat
cttgtttactgtgcatctacaagtgctggtaaaagttttgttgctgaagttttaatgcta
aggagagtggtatcaacaggaaagatggctcttcttgtacttccatacgtgtctatatgt
gcagaaaaggcagaacatcttgaagttcttttggaaccacttgataagcatgttcgcagt
tattatgggaatcaaggtggtggaacgcttccaaaggatacctctgtagctgtctgcaca
atcgagaaggcaaattctttaattaacagattactagaggagggtcgtctatcggagctt
ggtatcattgtcattgatgagctgcacatggttggtgaccagagtaggggttatttgttg
gaactcatgctgacaaagcttcgttatgctgctggtgaaggcaatgtagaatcatctagc
ggagaaaattcaagtatgagcagtgggaaatcggatgctgctcatggtctccaaattgtt
ggcatgagtgcaacgttaccaaatgtggctgcagttgctgattggcttcaagcagctctc
taccagacagactttcggcctgttccattggaggagtacattaaagttggtaacacaata
tacaacaaagaaatggaacttgtcaggacgctccccaaagtggctgaccttggtggtaaa
gatccagatcaaattgtagaactatgcaatgaggttgttcaagagggtcactcggtgcta
atattttgttcaagtagaaaaggatgtgaatcaacttctaggcatgttgcaaaatacctc
aaaaagttctctgtctgtccccatgatggccatagcgagtcaatcgatgttacttttgcc
attgatgccttgagaagatctcctgcagggttggatcctgtactagaagaaactcttccg
cttggtgttgcctaccatcatgctggcctcacagttgaggaaagagaaactgtcgaaacc
tgttaccgcaaaggacttgtacgtgtcttaactgctacatcaaccttagctgctggagtt
aacttgcctgcacggagagttattttcagacaaccccgtattggccgcgattttattgat
gggacgaggtataagcagatggctggaagggctggtcgaactggcatagacacaaaggga
gagagcgtactaatttgcaagccagaggaagtcaaaagaatatttgcacttcttaatgac
ggctgtccaccactgcactcttgtttatctgacgataagaatgggatgacccacgcaata
ttggaggttgttgctggtggaattgttcaaagtgctagcgatattaatcgttatgttagg
tgtactcttctcaattcaacaaaaccgtttgaagatgtggtgaaatcagcacaggactct
cttcgttggttatgccataagaagtttcttgaatggagcgaagagactaagttatatact
actacacctctaggccgtgcatcttttggcagttctctcagtccagaggagtcgcttatt
gtgctggacgatctgatacgagcaagagaaggatttgtgcttgcatctgatttgcatttg
gtgtacttggtgacacccattaatgttgatgtagaaccagattgggagttgtattatgag
agattcatgcaattaccttctttagaccagtcagttggcaatagagttggagtgcaagaa
cactttttaatgcgcatggctcatggagcaccaattcgtacctcacacagatcaagggat
agctcgaaagggttattgggaagatatgatcataggctcgggaagccaacccatggtatg
ctttcagatgatcaaatgcttcgggtgtgcagacggctctatgttgctcttatcttgtca
cgacttgtgcaggaagtccctgttgctgaagtttgtgaagcttttaaagtagcaagaggc
atggttcaagccttacaagaaaatgctggaaggtttgcatctatggttactgtattctgt
gagagactttcttggcatgaccttgagggcttagttgccaaattccaaaatcgcgtttca
tttggagttcgagcagagattgtagagctcactaccattccttacattaagggttcacga
gctagagtactttataaggctggtttacgaacgcctcaggcaattgctgaagcatcagtt
cctgaaattgtcaaagtgcttttcgagacttcatcttgggctacgcaaagctcagcacaa
cggaggatagagttgggagttgctaagaagataaaaaatggtgcacgcaaaattgttctc
gataaagctgaagaggcaagggttgctgctttctcagcctttaaatctcttggacttaaa
gttccagagttctctcgaccattactatccgctgtttctggagatgcccctaaaaaagaa
tcaacaaattcttctggagaggagtccaccagtagctttgctggtctagatgatagcaag
catgttctagatgccttgtcattcaaggaaaagaggaaaactggtggggttatttctgaa
actgaggaaggtaaatcaacagagacttccactgtcggtttagcatcttcagtgaaagga
aatccagcaggcacctcgcttggtgaacttgtggagaagcctgctttgcttgaggaaggg
gttaatactctgggtgatgggcttcatagcactacccaacatattaacgatgcgaacaca
tcagacgttgacaataaaagaaatgaatccgatgagcatgttgataatggagggcagcaa
cagcctgagagagaaaacatgtgtaggggaaccagaggaaatgaattagagatgggtcct
gtgaatgcaactagttttcctggtggatttgattcttttttagatctctgggatgctagt
ggagagttctactttgatattcattttaccaaaagatctgaactgagctccattgtgcca
ttcgaaatacatggcatggcagtttgctgggaagattctccagtgtattacttgaatttt
cccaaggatttacgcaggtgtaacggccgaagaaatgatcacgctactgaggattgtaag
tatgttctaccaccaaaggatcagatggagatagctaaggaacgatggaacagaattggg
attataatggggaaaaaagatgtaaaaaaacttacatggaacttaaaatttcagattcag
gtgcttaagaggcctgcagtttctgttcacagatcaagcagcatgcatgctgaagttaaa
actctaagtctggatcttatcgaaaattcatactatatgttatcccctattcacgtacaa
aatgcagtcgatatgtgtatagtagcatggatactttcaccagacgaggagaaaagttca
aatcctagtttggagaaggaagttaagaaacggttatccagcgacgctgctgcagctgct
aatcgaaatggtagatggaataatcagatgcgaagagtggcacataatggttgctgtcgc
cgagctgcacaaacacgagcactgcattctgttctctggaaattactagtttctgaagaa
ctaattgagacacttgtgactactgaaattccattggtcaatgttcttgctgatatggag
atatgtggaataggtgttgacatggagagatgtcttagggcacggcatattctaaggact
aaacttaagtatcttgagaaggaagcttatcaattggctggcatgaaattttcattgtcc
atgtcagcggacatagctaatatcctatatggacacttaaagctgcccaaaccagaaggg
tacgaagggaaactacaccctagcactgacaaacattgcttggatatgctgaggaatgag
catcccattgttccggtaatcaaagagcaccgaaccttggcaaagctcttgaattctact
ctgggatccatttgttcacttgctagactttctatgaggacacagaagtacactttgcat
ggtcattggcttcagacatcaacagcaactgggagactgtcaatggaggaaccgaatctc
cagtgtgttgagcatatggttgaattcaaaataaataacaacgataaagatgatgatgaa
tcaggttctggtcattataagattaatgctcgagatttttttgtacccactcaggatgat
tggttacttctaacagcagattattcacagatagaattaagaatgatggcccatttctct
aaagattctttgttggttgagctactaagtgatccccagggagatatctttgcaatgatt
gctgcaaaatggacggggaaagataactgtgatgttacttcacaagagcgaaatcaaaca
aaaagattggtttatggcattctctatggaatgggacctaacacccttgcagaacagttg
gactgcagttcaaatgaagctgcagaaaaaattcaaaccttcaaaaaatcttttcctggt
gttgcttcctggcttgaggaagcagtaaaatcctgccgtaagaaaggttttatcaagacc
ctcaagggacgaaaacgcttcttgacaaaaataaagtttggaaacagtaaagaaaaatcc
aaagctcagagacaagctgtgaattctatatgtcagggatctgctgctgacataatcaaa
attgctatgataaatatacattctgttattgttgatgatgctgaagcttttcatcctagt
tctgtatttgctgaaaaattttatatgctgaaaggtcgctgccgattacttctacaggta
catgatgaacttgtactggaaaccgatccttcagtagttaaggaagctgggttgttgctt
caaacttgtatggaaagtgccatgtcacttcttgttcctttgcctgtcaaattgaaagtt
ggcagaacatggggatctttggagcctttcatgcctgagaaatgcaacgatgatgtaaca
ttgcctggttcttag

DBGET integrated database retrieval system