KEGG   Olea europaea var. sylvestris (wild olive): 111384397Help
Entry
111384397         CDS       T05244                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111384397
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111384397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111384397
NCBI-ProteinID: XP_022864441
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVAVLKSSEGVNGTVYFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINVVDKQIPLTGPHSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgtcgcagtcctcaaaagcagtgagggtgtcaatggcaccgtctacttc
acccaagaaggagatggtccaactactgttactggaaacatttctggccttaagcctgga
cttcatggctttcatgtccatgccctcggtgacaccaccaatggttgtatgtcaaccgga
cctcatttcaatcctgttggcaaagagcatggtgcacctggagatgagaaccgccatgcc
ggtgatcttggtaacatcacagttggagaagatggcactgctgctatcaacgttgttgat
aagcagatacctcttacaggaccacattctataattggaagagccgtagttgtccatgca
gatcctgatgatcttggaaagggtggtcatgaactgagcaagagcactggaaatgctggt
ggaagagttgcttgtggtatcattggccttcaggcttga

DBGET integrated database retrieval system