KEGG   Olea europaea var. sylvestris (wild olive): 111386701Help
Entry
111386701         CDS       T05244                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu03030  DNA replication
oeu03410  Base excision repair
oeu03420  Nucleotide excision repair
oeu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111386701
   03410 Base excision repair
    111386701
   03420 Nucleotide excision repair
    111386701
   03430 Mismatch repair
    111386701
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oeu03032]
    111386701
   03400 DNA repair and recombination proteins [BR:oeu03400]
    111386701
Enzymes [BR:oeu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111386701
    6.5.1.6  DNA ligase (ATP or NAD+)
     111386701
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111386701
DNA replication proteins [BR:oeu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111386701
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111386701
DNA repair and recombination proteins [BR:oeu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111386701
   NER (nucleotide excision repair)
    Other NER factors
     111386701
   MMR (mismatch excision repair)
    Other MMR factors
     111386701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Presenilin ORC6
Motif
Other DBs
NCBI-GeneID: 111386701
NCBI-ProteinID: XP_022866934
LinkDB All DBs
Position
Unknown
AA seq 841 aa AA seqDB search
MLSVLSCRHCWNLNTLSCNFARKRALKFSISFSLNLQGPFSSKPLLALPKQKFTYGTMSD
SLPSAFDILMSNASRKNQNSSQTQKEKRQSSPRKRKAPAENSQTPHLNPNNSPTQSERTV
KQERSSLKDSNSAQINDARFKNSVENDEKATVGSSSVENSNRERIIVQESSSKQNVARNA
DLNEDLGLAKKAKVSISPDESIVELKKKATSFDAKRAAYWGKGERIPFMFVAKTFDAISK
ESGRILITEIVCNMLRTVIEMTPDDLVAVVYLLANRIAPAHEGLELGIGDSSIIKALAEA
CGTKEVHIKKQYKELGDLGLVVKASRSSQPLMRKPEALTVAKVFDTFRLIAKESGKDSQE
KKKTHIKGLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGHAAVYSEQQSSPPANVD
NPLEEAAKIVKQVYSVIPVYDKIVPALLAGGVWNLPKSCSFSPGIPVGPMLAKPTKGVSE
IVDKFQDMEFTCEYKYDGERAQIHYMGNGAVEIYSRNAERNTGKFPDVVAAITRLKKPSV
MSFVLDCELVAYDREKQKILPFQVLSTRARKNVVMSEIKVDVCIFAFDILYLNGQELLQE
QLDIRREHLYKSFQEEQGLVQFATAITSNDLEEIQKFLDGAVDSSCEGLIIKTLSKDATY
EPSKRSHNWLKLKKDYMESIGDSLDLVPIAAYHGRGKRTGVYGAFLLACYDSNKEEFQSI
CKIGTGFSEAMLEERSASLRSKVIPKPKSYYRYSDSINPDVWFEPTEVWEVKAADLTLSP
VHRAAIGIVDSDKGISLRFPRLLRIREDKSPEQASSSDVVAEMYTAQKHNQRENQDENDN
D
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagtgctgtcatgccgccattgttggaacttgaacacactctcatgtaatttc
gcaagaaaacgggcactcaaattctccatttctttttctctaaacctccaaggacccttc
tcttcaaaacccttattagcattaccaaagcaaaagtttacatacggaacgatgtccgat
tctctcccctcagcctttgacattctcatgtcgaatgcttcaagaaaaaatcaaaactct
tcacaaactcagaaggaaaaacggcaatcatcgcccaggaaacgcaaggccccagctgaa
aattcccaaacaccccatttaaaccctaacaattctccgactcaaagtgaaagaaccgta
aaacaagaacgatcaagcctcaaggactcaaattccgctcaaattaatgatgcccgtttc
aagaactcggtggaaaacgacgaaaaagcaacagttggttcatcctctgttgaaaatagt
aatcgagagagaataatagttcaagaatcaagctcaaagcaaaatgtagcaagaaatgct
gatttgaatgaagacttggggctggctaagaaggcgaaagtgtcgattagtccggatgag
agtattgtggagttgaagaagaaggctaccagttttgatgcgaagagagcggcatattgg
ggaaagggagagaggataccttttatgtttgtggcgaagacatttgatgcgatatcaaag
gagtcggggaggatcttgatcacggagattgtgtgtaatatgctgaggactgtgattgaa
atgacaccggatgatttggttgcagtcgtgtatcttctggcaaataggattgctcctgcg
catgaggggttggagctcgggattggagactcttcaattatcaaggcgcttgcagaggct
tgtggtactaaagaagtgcatattaagaagcaatacaaggagctcggagatttaggcctt
gttgtgaaagcaagccgttcgtcacagcctttgatgcgtaaaccagaagcattaactgtt
gccaaagtttttgatacatttcggctcattgccaaggaatccggcaaggatagtcaagag
aagaaaaagactcacataaagggactactagttgcagccactgattgcgaacctcaatat
ttgattcgtctactccagacaaagctgcgcattggtttagcagaacaaactctcttggca
gcactggggcatgctgctgtgtattctgagcagcagtcatctcctcctgcaaatgttgat
aatccattagaagaggctgcaaaaattgtgaaacaagtttactctgtaattccggtctac
gataaaattgttcccgctcttcttgctggtggtgtatggaatctcccaaagtcatgtagc
ttttcaccaggtattccagttggacccatgttagctaaaccaactaaaggagtatcagaa
attgtggataaattccaagacatggagtttacgtgcgaatacaagtatgatggagaacgt
gctcagatacattatatgggaaatggtgcagtagagatatatagtagaaatgcagaacgg
aatactggaaagtttcctgatgttgttgctgctatcacaagattaaagaaaccttctgta
atgtcatttgtcctcgactgtgaacttgttgcatatgaccgtgagaaacagaaaatcctg
cctttccaggtcctcagtacacgtgctcgtaaaaatgttgtcatgagtgaaatcaaagtt
gatgtttgcatatttgcttttgatatcttgtatcttaatggacaagagcttctgcaggag
cagcttgacattcgtagagagcatctttacaagtcatttcaggaagaacaaggtcttgtc
cagtttgccactgctataacatcaaatgatctagaggaaatacaaaaatttcttgatggt
gctgttgattctagttgcgaggggttgatcatcaaaacattgagtaaagatgctacatat
gaaccttcaaaacggtctcacaactggttaaaattgaaaaaagattacatggaaagtatt
ggtgactcgctggatttggtgcccattgctgcttaccatggcaggggaaagcgaactggt
gtatatggcgcctttctccttgcttgttatgacagtaacaaggaggaatttcaaagcatc
tgtaaaattggcactggattttctgaagcaatgcttgaagaacgttctgccagccttcgt
tctaaagttattcccaagccaaagtcatactacaggtattcagattcaatcaatccagat
gtctggtttgaacccactgaggtttgggaggtgaaagctgcagatctgactctaagccct
gttcatcgtgctgccattggtattgtagattctgataaggggatctcgctgcgatttcct
cgtttgcttcgtatccgagaagacaagagtccagagcaggcctcgtcgtctgatgtggta
gccgagatgtatactgctcagaagcacaatcaacgagaaaatcaagatgaaaatgacaac
gattga

DBGET integrated database retrieval system