KEGG   Olea europaea var. sylvestris (wild olive): 111389170Help
Entry
111389170         CDS       T05244                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00020  Citrate cycle (TCA cycle)
oeu00190  Oxidative phosphorylation
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111389170
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111389170
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111389170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_18 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 111389170
NCBI-ProteinID: XP_022869824
LinkDB All DBs
Position
Unknown
AA seq 279 aa AA seqDB search
MATGLIRRAIARVPASVPTARVILNRVHSSEAKAQLVEPSSKPTSNIKTFQIYRWNPDST
QKPELQNYEVDLKECGPMVLDALIKIKNEADPTLTFRRSCREGICGSCAMNIDGRNGLAC
LTKIPSGGASMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPENAGKEILQSKD
DRKKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWIMDSRDEYTKERLEAVN
DEFKLYRCHTILNCAKACPKGLNPGMQIQNIKKLERTGF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccggcttgatcagacgggcaatagctagggttccggcgtcggtgccgacggcg
agagtaatcctcaaccgggtccactcctcggaggccaaggcccaattggtggaaccaagt
tcgaagcccacaagcaacatcaagaccttccaaatctacagatggaacccggacagtact
cagaagccggagctgcaaaattacgaggttgacctcaaggagtgtggaccaatggtcctg
gatgctctaatcaagataaaaaacgaggccgaccctacattgacattccggcgatcttgc
cgtgagggaatctgcggttcgtgtgctatgaacatcgacggccggaatgggctagcctgt
ttgacaaagatcccatctggtggggcatctatgattactcccctgccccatatgtttgtg
atcaaggatcttgttgtggatatgactaatttttataaccaatataagtctattgagccg
tggctgaagaggaaaaacccgccagagaatgccgggaaagagattctgcagagtaaggac
gatagaaagaaactcgacgggatgtatgagtgcattttgtgcgcctgctgtagcacatcc
tgccccagctactggtggaatcccgagtcttatctcggccctgctgccctattgcatgcc
aatcgatggataatggatagccgtgatgaatacaccaaagagcgccttgaggcagtaaat
gatgagttcaagttatatcggtgccataccattttgaactgtgctaaagcttgcccaaag
ggactgaatcctggaatgcaaatccagaacatcaagaaacttgagcgcactggattttaa

DBGET integrated database retrieval system