KEGG   Olea europaea var. sylvestris (wild olive): 111390908Help
Entry
111390908         CDS       T05244                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00630  Glyoxylate and dicarboxylate metabolism
oeu00710  Carbon fixation in photosynthetic organisms
oeu01100  Metabolic pathways
oeu01200  Carbon metabolism
Module
oeu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oeu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oeu_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111390908
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111390908
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111390908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 111390908
NCBI-ProteinID: XP_022871796
LinkDB All DBs
Position
Unknown
AA seq 169 aa AA seqDB search
MSATGFSAVVAGSTYAGLTSNCSKIFPQKDSVSWSKKTVSNGSKTHCMKTWNPINNRKFE
TLSYLPPISDESIAKEIDYMIKKGWIPCLEFDEVGCVHRENSRMPNYYDGRYWTLWKLPM
FGCNDSSQVLNEIHECKKEYPNAYIRCLAFNNVKQAQCMAFLIQKPNTA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactggtttctcagctgtggttgctggatcaacctatgcaggtttgacatcc
aattgctctaagattttccctcagaaggactcagtttcttggagcaagaaaactgtttca
aatggctctaaaactcactgcatgaagacttggaaccccatcaacaacaggaagttcgag
accctttcatatcttccacctatctccgatgaatcgattgcaaaggagattgactacatg
atcaaaaagggatggatcccttgtcttgaattcgacgaggtgggatgtgtgcacagagaa
aacagcaggatgccaaattactatgatgggagatactggactctgtggaagctgcccatg
tttggctgcaatgactcctctcaagttctgaatgaaattcatgagtgcaaaaaggaatac
cccaatgcttatattcgctgtttggcatttaacaacgtcaaacaggcacagtgcatggca
tttctcatccagaagccaaacaccgcctaa

DBGET integrated database retrieval system