KEGG   Olea europaea var. sylvestris (wild olive): 111391584Help
Entry
111391584         CDS       T05244                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase isoform X1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00620  Pyruvate metabolism
oeu00710  Carbon fixation in photosynthetic organisms
oeu01100  Metabolic pathways
oeu01200  Carbon metabolism
Module
oeu_M00168  CAM (Crassulacean acid metabolism), dark
oeu_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
oeu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
oeu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:oeu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    111391584
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111391584
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111391584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 111391584
NCBI-ProteinID: XP_022872596
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MASRNLEKLASIDAHLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGGKNDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRI
KKKKGDYTDESSAATESDIEETLKRLVVDLKKSPQEVFDALKNQTVDLVFTAHPTQSIRR
SLLQKHGRIRHCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYSKIEDLMFELSMWRCSDELRVRADELHRSSKRDTKHYIEFWKQV
PPNEPYRVILADVRDKLYQARERSRHLLAHGISDIPEEATYTNVEQFLEPLELCYRSLCA
CGDRPVADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDIGSYREWSEER
RQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFHVLAELPPDCFGAYIISMATAPSDVLA
VELLQRECHVKTPLRVVPLFEKLDDLEAAPAAVARLFSIDWYRNRINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVAPKPEWRALLDEIAVAST
EEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKYALQKDIKNLKMLQEMYNGWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWSFGQRLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNVSQ
AYALKRIRDQNYHVKLRPHICKDYMESSSAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaggaatttggagaaactggcatcaattgatgcccatttgaggcttttggtg
cctgggaaagtgtccgaggatgacaagcttgttgagtatgatgctctgctgttggatcga
tttctagatattcttcaggatttgcacggagaggatctcaaggaaacggtacaagagtgt
tatgaactttctgctgaatatgaaggtggcaagaatgatccaaaaaagttagaggagctt
ggaaatgtgttgactagtttggatccgggggattcaattgtaattgcaaaagcattctct
cacatgcttaacttggccaacttggctgaggaggttcagattgcttaccgccggcggatc
aaaaagaaaaagggtgattatactgatgaaagctctgcagctactgaatcagacattgaa
gagactcttaagagacttgtggttgatttaaagaagtccccacaagaagtttttgatgca
ttgaagaatcaaactgtggatttggtgtttactgctcatccaactcaatctattcgaaga
tcgttacttcagaagcatgggagaattcgacattgcttggctcagttgtatgccaaagac
attacacctgatgataaacaggagcttgacgaggctttacagagggagattcaagctgcc
ttccgaactgatgagatacgaaggactccccctaccccacaagatgaaatgagagctgga
atgagctacttccacgagacaatctggaatggcgtgccaaagtttttacgccgtgttgat
acagcacttaagaatatcggaattaacgaacgcgttccttacaatgcccctctaattcag
ttttcttcttggatgggtggagatcgtgatggcaatccaagggtaactcctgaggtcaca
agagacgtttgcctattggctagaatgatggctgctaacttgtactattccaaaatagag
gatctcatgtttgagttgtctatgtggcgttgcagtgatgagcttcgtgttcgagcggat
gaactccatagatcttcaaagagagatacaaagcattacatagaattttggaaacaagtt
ccacccaatgaaccctatcgagtcattcttgctgatgtgagagataagctctatcaggca
cgtgagcgttctcgccatttattagcgcatggaatatccgacattccggaggaggcaact
tacaccaatgttgagcagttcttagaacctctcgagctctgctacagatccctttgtgct
tgtggtgaccggccggtagctgatggaagccttctggatttcctaaggcaagtttccacc
tttggtctctcacttgtgagacttgatataagacaagagtcggacagacacactgatgtc
ctggatgccattaccaaacacttggatattggttcatatcgagaatggtcagaagagcgt
aggcaggaatggcttctatctgaacttagtgggaagcgacccctctttggaccagatctt
ccgaaaactgaagagattgctgatgttttggatacattccatgtcttagctgaactccca
ccagactgctttggagcatatattatctctatggctactgcaccatctgacgtgttagca
gttgagcttctgcagcgtgaatgccatgtgaagaccccattaagagttgttccacttttt
gagaaattagatgatcttgaagctgctcctgctgctgttgcacggcttttctctattgat
tggtacagaaatcggattaatggtaagcaagaagtcatgattgggtactcagactctggc
aaagatgctggtcgactgtcggcagcatggcaactgtacaaggctcaggaggagcttatc
aaagttgcaaagcagttcggagtgaagttgactatgttccacggtcgaggtgggacagtt
ggaagaggaggtggccctactcaccttgctatattgtcccaacctccagatactatacat
ggatctctccgtgtcacagttcagggagaagttattgagcaatcatttggggaggagcac
ttgtgtttcagaacactccaacggtttactgctgctacacttgagcatgggatgcatcca
cctgtcgcccctaaacccgagtggcgtgcacttttggatgaaattgctgttgcttccaca
gaagagtaccgctcaattgtattcaaagaaccccggtttgtcgagtatttccgccttgct
acaccagaattggagtacggtaggatgaatatcggtagtcgcccatcaaagcggaaacca
agtggaggcattgaatcactcagagctattccatggatctttgcctggactcagaccaga
tttcatctccctgtttggcttggttttggagcagcctttaaatatgcactccaaaaggac
ataaagaacctcaaaatgctacaggaaatgtacaacgggtggcctttctttagagtcact
atcgatctagttgagatggtgtttgccaagggagaccctggtattgctgctctttatgat
aaactcctcgtttcagaagatctttggtcgtttggtcagcgtttgagggccaactacgag
gaaacaaagtctcttcttcttcagattgctggacataaggatcttctagaaggggacccc
tacttgaagcaacgacttcgtttgcgtgattcgtacattacaactttgaatgtgagccag
gcttacgctcttaagcgaattcgtgatcaaaactatcacgtgaagttgaggcctcatatc
tgcaaagattatatggaatcaagctcggctgctgaacttgtgaagttgaacccgacaagt
gagtatgcccctggattggaggacaccctcatcttgaccatgaagggtattgcagctggg
ttgcagaacaccggttaa

DBGET integrated database retrieval system