KEGG   Olea europaea var. sylvestris (wild olive): 111399420Help
Entry
111399420         CDS       T05244                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00010  Glycolysis / Gluconeogenesis
oeu00051  Fructose and mannose metabolism
oeu00052  Galactose metabolism
oeu00500  Starch and sucrose metabolism
oeu00520  Amino sugar and nucleotide sugar metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oeu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111399420
   00051 Fructose and mannose metabolism
    111399420
   00052 Galactose metabolism
    111399420
   00500 Starch and sucrose metabolism
    111399420
   00520 Amino sugar and nucleotide sugar metabolism
    111399420
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111399420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oeu04131]
    111399420
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111399420
Membrane trafficking [BR:oeu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111399420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111399420
NCBI-ProteinID: XP_022882495
LinkDB All DBs
Position
9
AA seq 498 aa AA seqDB search
MGKVVAAAAVVCTAAVCAAAVLVMRHRMKSSGRWAKAEAILRELEEKCGTPTGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISYVDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKEKH
VVKRESEELSIPPHLMVGSPNDLFDFIAAAVAKFVATEGADFVLPPGRQRELGFTFSFPV
KQISLASGTLIKWTKGFLIEDAIGQDIVEELTKAMERIGLDMHVTALVNDTVGTLAGGRY
NNADVIAAVILGTGTNAAYVERANAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ILDAESLNPGEQIFEKIISGMYLGEIVRRVLCRMAEEASFFGDDIPPKLRDPFILRTPDI
AAMHHDTSTDLKVVGSKLNDILEVPNSSLKMRKMIVEICDIVATRGARLSAAGILGILKK
LGRDTVKEGEKQRSVIALDGGLFEHYPEFRNCLINTLKELLGEEVSESVVVELSNDGSGI
GAALIAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtcgtggcggcggcagcggtggtgtgtacggcggctgtatgtgctgcagct
gtgctggtgatgagacaccggatgaagagctctgggaggtgggccaaagcggaggccatt
ttaagagagctggaggagaagtgtgggaccccaactggtaagctccggcaggtggctgac
gccatggctgttgagatgcacgccggcctcgcctccgaaggcggcagcaaacttaagatg
ctcatcagctatgttgataaccttcccactggggatgaagaaggagtattttatgcattg
gacctagggggcacaaacttccgagtcctgcgagtgcagcttggtggaaaagaaaaacat
gtggtcaaaagagaatccgaagaactttcaattcctccacatttgatggttgggtcacct
aatgatttgtttgattttatcgctgctgcagttgcaaaatttgttgcaacagaaggtgca
gactttgttcttccacctggcaggcaaagggagctgggtttcaccttttccttcccagtt
aagcaaatatcgttggcatctggaactcttataaagtggacaaaaggcttccttatagaa
gatgcaataggacaagatattgtcgaagagttgactaaagcaatggaaagaattggcctt
gatatgcatgtgactgctttggtcaatgatacggttggaactttagccggaggacgatac
aacaatgctgatgtgattgctgcggtgatcttgggtactggaaccaatgccgcatatgta
gaacgggctaatgctattccaaagtggcaaggtctacttcccaaatctggggaaatggtt
ataaacatggaatggggtaacttccgatcatcacatcttccgttaacagaatatgatcaa
attcttgatgctgaaagcttaaatcccggcgagcagatttttgagaagataatttctggc
atgtatttgggagaaattgtacgtcgagtcttgtgcaggatggcagaagaagcatccttt
tttggggatgacatcccgcctaaacttagagatccattcatattaaggactcctgacatt
gcggcaatgcatcatgacacttctactgatctaaaagtggttgggagcaaattaaatgat
atcttggaggtaccgaattcttccttaaaaatgaggaaaatgattgtggagatatgtgac
attgttgccactcgtggggcccgactttcagctgctgggatcttaggaattctcaaaaaa
ctgggacgagatactgtaaaagagggagagaagcagaggtctgtaattgccttggatggt
ggattgtttgagcactatcctgaattcagaaattgtctgattaacactcttaaagagctc
ctgggggaagaggtttcagagagcgttgttgttgagctttccaatgatggctctggcatt
ggagctgcactcattgcagcttctcactcccagtaccttgaagttgaggagtcctaa

DBGET integrated database retrieval system