KEGG   Olea europaea var. sylvestris (wild olive): 111401807Help
Entry
111401807         CDS       T05244                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3A
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oeu03021]
    111401807
   03036 Chromosome and associated proteins [BR:oeu03036]
    111401807
Transcription machinery [BR:oeu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     111401807
Chromosome and associated proteins [BR:oeu03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    111401807
   PBAF complex
    111401807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 zf-SNAP50_C
Motif
Other DBs
NCBI-GeneID: 111401807
NCBI-ProteinID: XP_022885487
LinkDB All DBs
Position
10
AA seq 573 aa AA seqDB search
MEKNCQELESYSVPSSSNWFSWSNIHEVERFSLREFFDGSSITRSPRIYKEYRDFIISKY
REDPSRKLTFTEVRKSLVGDVSILHKVFTFLEKWGLINFDVKRNNEGDNCNGNGKTTSVG
GEEEEEESWKGRVKLEEGAPYGVRVVAAPNSMKPVAQLPPPTSVSVDGGRGIGEVGHNGF
KWPPLASYSDVFADLAQQEKKGLVCRSCKENCDSMHYEYTKEGSFILCEKCFKSGNYEEN
NSADDFKLINSGNQNNVWTEAETLHLLESVLKHGDDWDLVAQDVQTKSKMDCISKLMELP
FGDRMLGSAQRKRKFLDLTGDVSNLKQGKLAFKESQESAKVEDPSHELKDEGQQNGYTDT
EGQPLKRIRMEPTSNTTYLMNQVARISTAVGPHVTASAAEAAVTALCYENQCSREVFDED
NIFVDLKASAENIEQKRAAQGNLLDGDEGPKQSEIQGPSSEKDTIQINLRMRAATATALG
AAAAHAKYLADQEERRMEQLMAIMIETQMKKLKRKMKYFDELELIMEKENAHIEELEESL
VADRLNVLQRIFNAGISRWKDHASMKSETGSVQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaattgtcaggaactcgagtcctactcagtcccaagctcctccaattggttt
tcttggagtaacatccacgaagtggagagattctcattgagagagtttttcgatgggagt
tcaatcacaaggtcacccagaatctataaggagtacagggatttcataatttcgaagtat
agagaggacccttcgaggaaattgacgtttaccgaggttcgaaagtcattggtaggagat
gttagcattctccataaagtatttacctttttagaaaaatggggtctcattaattttgat
gttaaaagaaataatgaaggtgataattgtaatgggaatggtaaaacgacttccgttggg
ggtgaggaggaggaggaggagagttggaaggggagggtgaaactggaagaaggggcccca
tatggggtgagagtggtggcagctccgaattccatgaaacctgttgcgcagctgccccca
ccgacatctgtcagcgtggatggtggtagagggatcggggaggttgggcataatggattc
aagtggccaccattggcatcttactcagatgtttttgcggatttggcacagcaggagaag
aagggcttggtgtgtaggagttgtaaagagaactgtgattcaatgcactacgaatacacg
aaggaggggagctttattctttgtgaaaagtgcttcaaaagtggtaattatgaggagaac
aattcagcagatgatttcaaattaataaacagtgggaatcaaaacaatgtctggacagaa
gcagaaactttacaccttttggaatctgttttgaaacatggagatgactgggatcttgtt
gctcaggatgttcagacgaaaagtaaaatggattgtatatcaaaactaatggagcttcct
tttggagatcgcatgttgggttcagcccagaggaagaggaaatttttggatttaactggt
gatgtaagtaatttgaaacagggaaagcttgcttttaaggaatctcaagaatctgcaaaa
gtagaggacccaagccacgagcttaaggatgagggccagcagaatggatataccgacacg
gaaggtcaacctctgaaaagaatacgcatggaaccaacttcaaataccacttatttgatg
aaccaggttgctcgcatatctaccgcagttgggcctcatgtcacagcttctgcagctgag
gcagctgttacagctctttgttatgaaaaccagtgttccagggaagtatttgatgaggat
aatatttttgttgatcttaaagcttcagctgaaaatattgagcaaaagagagcagctcag
ggtaatcttttagatggagatgaagggcccaaacaatctgaaattcaaggcccatcatct
gagaaggatacaatacaaataaacttaagaatgagagctgccaccgcaacagcccttggt
gctgctgctgctcatgccaaatatttggctgatcaagaagagagaaggatggaacaattg
atggctatcatgattgaaactcagatgaagaaattgaaacgcaagatgaagtattttgat
gaactggaattgattatggaaaaagaaaatgcccacatcgaggaactggaggaatctctg
gtagcagatcgactaaatgtcttgcaaaggatattcaatgcgggaatatccagatggaag
gatcatgcctcgatgaaatcggagacgggttctgtacaatga

DBGET integrated database retrieval system