KEGG   Olea europaea var. sylvestris (wild olive): 111403936Help
Entry
111403936         CDS       T05244                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111403936
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111403936
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   111403936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo APH RIO1
Motif
Other DBs
NCBI-GeneID: 111403936
NCBI-ProteinID: XP_022888384
LinkDB All DBs
Position
11
AA seq 482 aa AA seqDB search
MVTSQFPNLTGDNLLKPFPSHVPLSVEVADAFSLDHVDLDFSDLFGPAPTRATLPLISED
SANFIIQSEVKELNYDEPAVIHSCSHSYVGPTSCLSNISKLNKLTLHERGYLFEFVDEVD
GEAQEKIPEAVIETIVPKKFTLEADGNSEKTVRLEDFEFLKVVGQGAFGKVYQVRKIGSS
EIFAMKVMRKDKIIKKNHAEYMKTERDILTKIDHPFIVKLRYSFQTKYRLYLVLDFINGG
HLFFQLYRQGLFREDLARIYAAEIVSAVSHLHAKGIMHRDLKPENIILDAEGHAMLTDFG
LAKQFDENTRSNSLCGTVEYMAPEIIRCGGHDKAADWWSVGILLYEMLTGKPPFVGGNRH
KIQQKILNDKIKLPAFLSSEAHSLLKGLLQKEANMRLGNGLRGSDEIKGHKWFKSISWKK
LEAREIQPSFLPLVAGKHCIANFDERWTNMPLLDSPAASPKCGENPFRGFSYVKLQPSTT
DL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggttacctctcaatttccgaacttgactggtgacaatttgttgaagcctttcccaagt
catgttcccctctcagtggaagtcgctgatgccttctcgttggatcatgttgatttggac
ttttctgacctttttggtccagcaccaactcgtgcaactttacctttgatatctgaagat
tctgcgaattttattatccaatctgaagttaaagaattaaattatgatgaaccagctgta
attcatagttgttcccattcctatgtgggtcccacatcttgtttaagtaatatatcgaag
ctcaacaagctcacattgcatgagagaggatatctatttgaatttgtggacgaagtagat
ggagaggctcaagagaaaattcctgaagctgttattgagacaattgttccgaagaagttt
actcttgaagctgatggcaattcagagaagacagtacggcttgaggactttgaatttttg
aaagttgttgggcaaggtgcattcggaaaagtgtaccaggtgaggaagattggttcgtca
gaaatattcgcaatgaaggttatgcgcaaagataaaattataaagaaaaaccatgctgag
tacatgaaaactgagagggatatattgacaaaaatagatcatcccttcatcgtgaagcta
agatattcctttcagactaaatacaggttataccttgtgcttgacttcatcaatgggggt
caccttttctttcaactctaccgtcaaggcctattcagagaggatttggcacgtatatat
gctgccgagattgtttctgctgtttctcacctccatgcaaaaggcataatgcacagggat
ctgaaacctgaaaatattattcttgacgcagaggggcatgctatgctaactgattttggg
cttgcaaaacaatttgatgagaacacaagatctaattccttgtgcggaacagttgagtat
atggcacccgaaatcattcgctgtggaggtcatgataaggccgcagactggtggagtgtg
ggaattcttctgtatgaaatgttgacagggaagccgccattcgtcggtgggaatcgtcac
aaaattcagcagaagatactcaacgacaaaatcaaattgccagcatttttgtcaagtgag
gctcattctctactgaaagggttgcttcagaaggaggcgaacatgcgccttgggaatgga
ctaagaggcagtgatgagataaaaggccacaagtggttcaagtcaatcagctggaagaaa
ttggaggctcgggaaattcaaccaagcttccttccactagtagcaggaaaacactgcatc
gccaattttgatgagcgttggaccaacatgccacttctagattctccggctgctagtcca
aaatgtggagaaaacccctttagggggtttagttatgtgaagctgcagcctagtactaca
gatctttga

DBGET integrated database retrieval system