KEGG   Olea europaea var. sylvestris (wild olive): 111405286Help
Entry
111405286         CDS       T05244                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00010  Glycolysis / Gluconeogenesis
oeu00053  Ascorbate and aldarate metabolism
oeu00071  Fatty acid degradation
oeu00280  Valine, leucine and isoleucine degradation
oeu00310  Lysine degradation
oeu00330  Arginine and proline metabolism
oeu00340  Histidine metabolism
oeu00380  Tryptophan metabolism
oeu00410  beta-Alanine metabolism
oeu00561  Glycerolipid metabolism
oeu00620  Pyruvate metabolism
oeu00903  Limonene and pinene degradation
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111405286
   00053 Ascorbate and aldarate metabolism
    111405286
   00620 Pyruvate metabolism
    111405286
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111405286
   00561 Glycerolipid metabolism
    111405286
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111405286
   00310 Lysine degradation
    111405286
   00330 Arginine and proline metabolism
    111405286
   00340 Histidine metabolism
    111405286
   00380 Tryptophan metabolism
    111405286
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111405286
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111405286
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111405286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 111405286
NCBI-ProteinID: XP_022889867
LinkDB All DBs
Position
12
AA seq 533 aa AA seqDB search
MAARRISSFLSRSLSLSPASFGRNYGFGRVMHRFSTAAVLEEPITPPVQINYTKLLINGL
FVDSASGKTFPTLDPRTGEVIAHVAEGEAEDINRAVSAARKAFDEGPWPKMSAYERARIM
LRFADLVEKHMDEIAALETWDNGKPHEQALKAELPMFVRLFHYYAGWADKIHGLTVPADG
PYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTGLYVAKLF
HEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARSNLKSVTLE
LGGKSPFIICEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHERVYDEFLEKAKARAIR
RTVGDPFKKGIEQGPQIDSEQFEKVLRYIRSGIESNATLECGGERVGSKGFFIQPTVFSS
VEDNMLIAQDEIFGPVQTILKFKDNDEVIKRANKTKYGLAAGVFTRSLDTANTVSRGLRA
GTVWVNCYDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgtagaatttcctcttttctctcacgttctctctccctttctcctgcttct
tttgggagaaattatggttttggaagggtcatgcacaggtttagtactgctgcagtactt
gaggaaccaattactccacctgtccagattaattacaccaagcttttgatcaatggactc
tttgttgattcagcatcagggaaaacctttcccactttggatcctcggactggagaagtt
attgcacatgttgctgaaggagaagctgaggatatcaaccgtgcagtatctgctgctcgc
aaagcgtttgatgaagggccctggccgaaaatgagtgcttatgaaagggcacggataatg
ctacggtttgctgatttggttgaaaaacacatggacgagattgctgcacttgagacctgg
gacaatgggaaacctcacgagcaagctctcaaagcagaactaccaatgtttgttcgtcta
tttcattactacgctggctgggcagataaaattcacggtctaacagttccagccgatgga
ccgtatcatgtgcaaactttgcacgaaccaattggtgttgcaggtcaaattattccttgg
aactttcccctgctcatgttcgcctggaaagttggtccggcactggcatgtgggaacacc
attgtgctgaaaactgcagagcaaacaccactgactggtttatatgtagcaaaactgttc
catgaggctggtcttccccctggtgtactaaatgtggtttctggatatggtccaactgct
ggtgcagctcttgctagtcacatggatgtggataagcttgctttcacaggatcaaccgac
actggtaaaattgtacttgagcttgctgcaagaagcaatctgaaatcggttaccctagaa
cttggagggaaatccccatttatcatatgtgaggatgctgatattgataaggctgtagag
caagcacattttgctctgttctttaaccaggggcaatgttgctgtgctggttctcgtact
tatgtccatgaacgtgtatatgatgagttcctagagaaagcaaaggcacgtgctattaga
cgtacggtcggtgatcccttcaagaaaggtatcgaacaaggtcctcagattgactccgag
caatttgagaaggttcttcggtacataagatctggcattgagagcaatgctacccttgaa
tgtggaggcgaaagagtcgggtccaaaggtttctttattcagcccactgtattttcaagt
gttgaggataatatgttaatagcacaggatgagatttttggccctgtgcagaccatccta
aaattcaaggacaatgatgaagtgataaaaagggcaaacaagacaaaatacggtctagca
gcaggtgttttcacaaggagtttggacactgctaacacagtgtcgcgaggattgagggct
ggcaccgtttgggttaactgctacgacgtttttgatgctgcgattccattcggtggatac
aaaatgagtggtataggcagggaaaaaggaatttacagcctcaacaactatctgcaggtg
aaggctgttgttactcctttaaagaatccagcatggttgtaa

DBGET integrated database retrieval system