KEGG   Olea europaea var. sylvestris (wild olive): 111405964Help
Entry
111405964         CDS       T05244                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00010  Glycolysis / Gluconeogenesis
oeu00020  Citrate cycle (TCA cycle)
oeu00620  Pyruvate metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111405964
   00020 Citrate cycle (TCA cycle)
    111405964
   00620 Pyruvate metabolism
    111405964
Enzymes [BR:oeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111405964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 111405964
NCBI-ProteinID: XP_022890871
LinkDB All DBs
Position
12
AA seq 479 aa AA seqDB search
MASLLQSRTPGLSFSSSLSSTPVRRPSAFFLKPRSGSRIPVVRAKIREIFMPALSSTMTE
GKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVINEGETAPVGAAIGIL
AETEDEIAEAKAKATSQSSLAPAPSTPKVEEPSPAPKLDAPSPAVAAAPAPTAAPSTPGK
VVATPFAKKLAKQHKVDIDKLVGTGPFGRITPEDVEKAAGITPASKSNVAAPAAPAASVA
PAAVPPKAPSSFPEIPGSTVVPFTTMQTAVSKNMVESLSVPTFRVGYPIATDALDALYEK
VKPKGVTMTALLAKSAAMALAQHPVVNATCKDGKSFTYNSSINIAVAVAINGGLITPVLQ
DADKLDLYLLSQKWKELVEKARAKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAI
MAVGASKPTVLADKDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPESLTM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccttttacaatcaagaactccaggcctctccttctcatcatccctcagttcc
actcctgtcagacgcccttctgcatttttcttgaaaccccgttctggatcacgaatccca
gtcgtgcgggcgaagattcgcgagatctttatgcccgcgttgagttcgaccatgacggag
ggaaaaatcgtcagctggattaaatcggaaggtgatgtgttgtcgaagggtgaatctgtt
gttgttgtggaatctgataaagctgatatggatgtggagacgttctatgatggaatattg
gcggccattgttattaatgaaggagagacggctcctgttggtgcggcgattggaatttta
gcagaaacagaggatgaaatagctgaagctaaggctaaagctacatctcaatcctccttg
gcccctgctccatcaacgcctaaggttgaggaaccctcgcctgcccctaaactagatgct
ccatctccggcagttgctgctgctccggctcccaccgcggctccttctacaccgggaaag
gtggtggcgactccatttgccaagaaattggctaaacagcacaaggtagatattgataag
ttggttggcacagggccgtttgggagaattacacctgaggatgtggagaaggcagctgga
attacgcctgcctccaagagcaatgtggctgcccctgcagctccagcggcgtctgttgct
cctgctgcagttccgccaaaagctccatcgagctttccagagattcctgggtcgaccgtg
gtgccatttactactatgcaaactgcagtgtccaagaatatggtggagagtttgtcagtg
ccgactttcagggttgggtatccaatcgccactgatgccctcgatgctctctatgagaag
gtgaagcccaagggcgtgacaatgactgcattgttagcaaaatctgcagcaatggcactg
gctcagcatccagtggttaatgcaacctgtaaagatgggaagagttttacatataatagc
agtataaatattgcagtggctgtggcaattaatggagggttgatcaccccagttcttcag
gatgctgataagttggatctttatctgttgtctcaaaaatggaaggagctggtggagaag
gcccgggccaaacaacttcaacctaatgagtacaattcaggaactttcacattgtccaat
ttgggcatgtttggagtggacagatttgatgctatcctccctccaggccagggagccatt
atggctgttggagcatcaaagcctactgttttagccgataaagatgggttctttagcgtc
aaaaataagatgctggtgaatgttacggctgatcatcgaattatttatggtgctgatttg
gctgcatttcttcaaaccttctcaaagattatcgagaaccccgagagcttgacaatgtag

DBGET integrated database retrieval system