KEGG   Olea europaea var. sylvestris (wild olive): 111406082Help
Entry
111406082         CDS       T05244                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00040  Pentose and glucuronate interconversions
oeu00051  Fructose and mannose metabolism
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111406082
   00051 Fructose and mannose metabolism
    111406082
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     111406082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C DUF43 Pyr_redox_2 Pyr_redox_3 UDPG_MGDP_dh_N Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-GeneID: 111406082
NCBI-ProteinID: XP_022891046
LinkDB All DBs
Position
12
AA seq 354 aa AA seqDB search
MGEESEENLAVWLLGVRTLKIQPYTLSPLGPRDVKVRMKAVGICGSDVHHFKNMRVANFV
VKKPMVMGHECAGIIEEIGSQVKSLAVGDRVALEPGISCRKCCLCKNGRYNLCPDMKFFG
SPPTNGSLANLVVHPANLCFKLPDNVSLEEGAMCEPLSVGVHACRRAGICPETKALIVGA
GPIGLVSMLAARAFGAPRIVIVDIDERRLSFAKDLGADQTIQVSKNIQDVREEVVKIQNA
IGAGADVSFDCVGFDKTMTMALDATRAGGKVCLVGLGQSEMNLPLTPAAAREIDVIGIFR
YRNTWPLCIEFLRAGKIDVKPLITHRFSFTQQGVEEAFEISSQGGNAIKVMFNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagaatcagaagagaacctggcagtatggcttcttggtgtcagaacacttaaa
atacaaccctacactctgtctcctcttggtccccgtgatgttaaagtccggatgaaggct
gttggcatttgtggaagtgatgtacaccatttcaagaatatgagagttgcaaatttcgtg
gttaagaagcctatggtgatggggcacgagtgtgccggtatcatagaagaaattgggagt
caagtgaagtcactggcagtgggtgatcgtgtagccttggagcctggtataagttgcaga
aaatgctgtctttgcaagaatggtagatacaatctatgcccggatatgaagttctttggc
tctcctccaactaatggttctcttgccaatctggtggtgcatcctgcaaatctgtgtttc
aagttacctgataacgtaagcttggaagaaggggccatgtgtgaacctcttagtgttggc
gtccatgcatgtagacgtgcaggcatctgtcctgaaaccaaagcattgattgtgggagcc
ggaccgataggcctcgtaagtatgctggctgctcgtgcttttggagctcccagaatagtt
attgttgacattgatgaacgccgtttatcattcgcaaaagaccttggcgctgatcagacc
attcaagtttcgaaaaatattcaggatgttcgagaggaagtggtgaagatacagaatgca
atcggtgctggtgcagatgtgagctttgattgtgttggtttcgacaagactatgacaatg
gctttggatgcaactcgtgcgggtggtaaagtatgcctggtcggattggggcagagtgag
atgaacctccctcttactccagccgccgcaagggagattgatgttatagggatatttagg
tatcggaatacatggccactctgtattgaatttctccgggctgggaaaatagatgtcaag
cctctgataacccacaggtttagttttacacagcagggggttgaagaggcctttgagatc
agttctcagggtggtaatgccattaaggtcatgtttaacttgtag

DBGET integrated database retrieval system