KEGG   Olea europaea var. sylvestris (wild olive): 111407430Help
Entry
111407430         CDS       T05244                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00020  Citrate cycle (TCA cycle)
oeu00190  Oxidative phosphorylation
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111407430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111407430
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111407430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 DAO Thi4 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 111407430
NCBI-ProteinID: XP_022892663
LinkDB All DBs
Position
13
AA seq 645 aa AA seqDB search
MWRCVSRGLRIPSKKSTAGDSLCRLFSTQSNVGGSSYTVVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMGSDGSCQGVIALNMEDGTLHRFRAASTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLEVLMLMSPTINETTFFLQDLEFVQFHPTGI
YGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDIVSRSMTMEIREGRGVGPL
KDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGE
VVTIKGDDPDAVTSGLLAAGEAACASVHGSNRLGANSLLDIVVFGRACANRVAEIRRPGE
SQKPLEKDAGERTIAWLDKLRNSNGSLPTSNIRLNMQRIMQSNAAVFRTQETLEEGCQLI
DKAWESFHDVKLKDRSLIWNSDLIETIELENLLINARITMHSAEARKESRGAHAREDFTK
RDDENWMKHTLGYWENEKVRLAYRPVHMNTLDDEIESFPPKARVY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtatcgcgtggcctccgcattccgtcgaagaaatctaccgccggcgac
tccctctgccgtctcttttcaactcaatcgaatgtgggagggtcgtcatacacagtggtg
gatcatacctatgacgctgttgtggtaggcgcaggtggtgctggtctgagagcggcgata
gggttgtcagagcatggattcaacacagcttgcattaccaagctctttcctactcggtct
catacagttgcagctcagggtggaataaatgctgcattgggaaatatgacagaagatgat
tggaggtggcacatgtatgatacagtcaagggaagcgactggctaggtgatcaggatgcc
attcagtacatgtgtagggaagctccaaaagcagttatagagcttgaaaattatgggcta
ccattctctaggaccgaagatgggaagatttatcagcgtgcatttggtggtcaaagccta
aactttggaaaaggtggacaagcatatcgttgtgcatgtgctgcagatcgaactgggcat
gcattgttgcatactctttatggccaggctatgaaacacaatacacaattttttgtggaa
tactttgccctggatttacttatgggtagtgatggtagctgtcaaggtgtaattgcctta
aatatggaggatgggacattacacaggttccgtgctgcctcaacaattctggctacaggg
ggctatggtagggcgtacttctctgctacctctgctcacacttgcaccggagatggcaat
gctatggttgctcgagctggactgcctctcgaggtgctaatgttaatgtctccaaccatt
aatgagacgactttctttttgcaggatctggaatttgtccagtttcatccaactggtata
tacggtgcaggctgtctcattactgaagggtctaggggtgaaggtggtattcttaggaat
agtgaaggtgaaagattcatggaacggtatgccccaacagctaaggatcttgcatcaaga
gatattgtctcgagatctatgacaatggagatccgagaaggccgtggtgtaggaccattg
aaagatcatatctatcttcacttaaatcacttacctcctgaggtcctcaaggagagactt
cctggaatatctgaaactgctgccatttttgccggcgtcgatgttacaaaagagccaatc
cctgttttacctactgtccattataacatgggtgggatcccaacaaatcaccatggagag
gtagttaccatcaaaggggatgatcctgatgctgtgacttctggactcttagctgctggg
gaagctgcctgtgcatctgttcatggttctaatcgacttggtgcaaattcccttcttgat
attgttgtgtttggacgggcttgtgcaaacagggttgctgagatccgtagaccaggagag
agccaaaaaccacttgaaaaggatgctggagagaggactattgcatggttggacaagctt
aggaattcaaatggttcccttcccacctcaaatatccggttgaacatgcagcggattatg
caaagcaatgctgctgtgtttcgtacgcaggaaacattagaagaaggttgtcagttgatt
gataaagcatgggagagcttccatgatgtcaagttgaaggacagaagcttgatatggaac
tcagacttgatagagaccattgagttggaaaaccttttaatcaatgcacgtatcaccatg
cactctgctgaagcaaggaaagaaagtagaggagcccatgcgcgtgaagattttacgaaa
agagatgatgagaactggatgaaacacactctgggatattgggagaatgaaaaagttagg
ctcgcctacaggccagttcacatgaacacgctggatgatgaaatcgaatcatttccccca
aaggcccgagtatattga

DBGET integrated database retrieval system