KEGG   Oxalobacter formigenes: BRW83_0499Help
Entry
BRW83_0499        CDS       T04835                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ofo  Oxalobacter formigenes
Pathway
ofo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ofo01100  Metabolic pathways
ofo01110  Biosynthesis of secondary metabolites
ofo01130  Biosynthesis of antibiotics
ofo01230  Biosynthesis of amino acids
ofo02024  Quorum sensing
Module
ofo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ofo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRW83_0499 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BRW83_0499 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BRW83_0499 (trpE)
Enzymes [BR:ofo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BRW83_0499 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ARQ45266
LinkDB All DBs
Position
complement(519925..521424)
Genome map
AA seq 499 aa AA seqDB search
MTELEFKALANQGYNRIPLIIEAIADLDTPLSLYLKLTQQNNGGKNSFLLESVVGGERFG
RYSFIGLPASTVLRAHGMKTEVVKNDKVIEVNEGNPLDFIAEYQSRFKVAIRPGLPRFCG
GLAGYFGYDTIRYIEPRLRESAPVDDLGFPDIQLLLTEELAVIDNLSGKLYLIVYADPTR
PEAYSQARQRLRELRAMLDKPAIAPAMDGSERTDVIRDFKKEDFLAAVERTKEYIANGDC
MQVVLAQRLKKPFTDSPLSLYRSLRALNPSPYLYYYHFDDQYIIGSSPEILVRQENVPEG
RKVIVRPLAGTRPRGATPEKDMQLASELLADTKEIAEHVMLIDLARNDIGRIATIGSVKV
TEKMAIEKYSHVQHIVSNVEGLLKPGLSNLDVLKATFPAGTLSGAPKVRAMEIIDEMEPV
KRGIYGGACGYLSFGGEMDLAIAIRTGVIYKDMLYVGAGAGIVIDSIPESELQETENKAR
AVIRAAEQVQDGMDDSSLQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgactgaactcgaattcaaggcactggccaaccagggctataaccgtattcccttaatc
atcgaagccattgccgacctcgacacccctttatctctttacctgaaactgacccagcag
aacaacggcggcaagaactcgtttctgcttgaatccgtcgtcggcggagaacgtttcgga
cgttattcatttatcggattgcccgcctctaccgttttgcgtgcacacggcatgaaaacg
gaagtcgtcaaaaacgacaaggtcatcgaagtcaacgaaggcaatcctctggactttatt
gccgaataccagtcccgcttcaaggtagccattcgtcccggccttccccgtttctgcggt
ggtctggcaggttacttcggttatgacacgatccgttatatcgaacctcgcttaagagaa
agtgcacctgtagacgacctcggttttccggacattcaactgctgttgaccgaggaactg
gctgtcatcgacaatctgtcaggcaagctctacctgatcgtttatgccgacccgacccgg
cctgaagcgtattcacaggccagacaacgcctgcgtgaactgcgtgccatgctcgacaaa
cccgccattgcacctgcgatggatggcagcgaacgcaccgatgtgatcagggacttcaaa
aaagaagattttctggctgctgtcgagagaaccaaggaatatatcgccaacggcgactgt
atgcaggtcgtactggcccagcgactgaaaaaaccgtttaccgattcgccgctttccctt
taccgctccctgagagcgctgaatccgtcgccctatctttattattatcatttcgacgac
cagtacattattggatcgtcgccggaaattcttgtccgtcaggaaaacgtacccgaaggc
agaaaagtgatcgtcaggccattggccggtacacgtccacgtggagcgactccggaaaaa
gacatgcagcttgcctccgaattgcttgccgatacaaaagaaatcgcagaacacgtcatg
ctgatcgatctggcccgaaacgatatcggccgtatcgccactatcggcagcgtcaaggtg
accgaaaagatggcgattgaaaaatattcccatgtccagcacatcgtctcaaacgtcgaa
ggtctgcttaaacccggcctgtcaaatctggatgtgttgaaagcaacttttccggccggc
acgctttccggtgcaccgaaagtccgggccatggaaatcatcgacgaaatggaaccggtc
aagcgcggcatttatggcggtgcctgcggttacctctctttcggtggagaaatggatctg
gccattgccatccgaaccggcgtcatctataaagatatgctctacgtgggtgcaggagcc
ggaatcgttatcgattccatacccgaatccgaattgcaggaaaccgaaaacaaggcaaga
gccgtcatccgtgccgcagaacaggtacaggatgggatggacgacagttccctgcaataa

DBGET integrated database retrieval system