KEGG   Oxalobacter formigenes: BRW83_2031Help
Entry
BRW83_2031        CDS       T04835                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ofo  Oxalobacter formigenes
Pathway
ofo00250  Alanine, aspartate and glutamate metabolism
ofo00410  beta-Alanine metabolism
ofo00430  Taurine and hypotaurine metabolism
ofo00650  Butanoate metabolism
ofo01100  Metabolic pathways
ofo01110  Biosynthesis of secondary metabolites
ofo01120  Microbial metabolism in diverse environments
ofo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ofo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BRW83_2031 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRW83_2031 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRW83_2031 (gadB)
   00430 Taurine and hypotaurine metabolism
    BRW83_2031 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BRW83_2031 (gadB)
Enzymes [BR:ofo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BRW83_2031 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ARQ46769
LinkDB All DBs
Position
2170058..2171455
Genome map
AA seq 465 aa AA seqDB search
MAYLSNTDLTRNDPIFGSPFVSKAANKKTFPNDEQNAYDVYQVVHDELYLDGNARQNLAT
FCQTFEEEELHALMDLSIDKNMIDKDEYPQTAAIENYCVHMIADLWNAPDSATTIGTSTV
GSSEACMLGGLAALWRWRAKRKAAGKPIDKPNMVCGPVQVCWLKFARYWDIEIREMPMRD
NHYVMAPEDMLSMVDENTIVVVPTLGQTYTGLYEPVKPLADALDKLQTEKGLDIDIHVDG
ASGGFLAPFCAPEMVWDFRLPRVKSISTSGHKFGLAPLGVGWVVWRETKDLPEGLIFHVN
YLGGDLPTFALNFSRPAGQVICQYYNLLRLGKEGYQRIHGDCYKTAQMLAEGLQMIGPFE
MIHSGKEQEGIPALTWKIKDGAKTNYSLYDLADHLRTRGWLVPAYSLPPHADNIIVQRIL
VKQGLSADMASLLLEDFKRSIDFFDSHQPHGFTGKEAQMGNHSGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcatacctaagcaataccgatctgactcgtaacgatccgattttcggctctcccttc
gtttcgaaggccgccaacaaaaagaccttcccgaatgacgagcaaaatgcttacgacgtt
tatcaggtcgttcacgacgaattgtatctggacggcaatgcccgccagaatctggccacc
ttttgccagaccttcgaagaagaagaacttcacgcactgatggacctgtcgatcgacaag
aacatgatcgacaaggatgaatatccccagacagcggccatcgaaaattattgcgtccac
atgatcgccgatctgtggaatgcaccggattccgccaccaccatcggtacctcgaccgtc
ggttcaagtgaagcctgtatgctgggcggtctggctgccctgtggcgctggcgcgcgaaa
cggaaagcggctggcaaaccgatcgacaaacccaacatggtttgcggtcccgttcaggtt
tgctggctgaaattcgcccgttactgggacatcgaaatccgtgaaatgccgatgcgtgac
aaccactacgtcatggcaccggaagacatgctctcgatggtcgatgaaaacaccattgtc
gtcgtaccgactctgggccagacgtataccggcctgtacgaaccggtcaaaccgctggca
gacgcactggacaaattgcagactgaaaaaggtctggacatcgacattcacgtcgacggt
gccagcggcggcttccttgccccgttctgtgctccggaaatggtatgggacttccgcctg
ccacgcgtgaaatccatcagcacctccggccacaaattcggtctggctcctttgggggta
ggctgggttgtctggcgcgaaacgaaagacctgccggaaggcctgattttccacgtcaac
tatctcggtggcgatctgccgaccttcgcactgaacttctcccgtcctgccggacaggtc
atctgccagtactacaacctgctgcgtctgggcaaggaaggttatcagcgcattcatggc
gattgctacaagacggcacagatgctggcggaaggcctgcaaatgatcggaccattcgaa
atgatccacagcggcaaggaacaggaaggcatccctgccctgacctggaagatcaaggat
ggcgcgaaaaccaattacagcctgtacgatctggcggaccacctgagaacccgcggctgg
ctcgtcccggcttactcgctgccacctcatgccgacaacatcattgtccagcgcattctg
gtcaaacagggtctgtctgccgatatggcttccctgcttctcgaagacttcaaacgctcc
atcgacttcttcgacagccatcagccacacggctttaccggcaaggaagcccagatgggc
aaccatagcggcagataa

DBGET integrated database retrieval system