KEGG   Oxalobacter formigenes: BRW83_2222Help
Entry
BRW83_2222        CDS       T04835                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ofo  Oxalobacter formigenes
Brite
KEGG Orthology (KO) [BR:ofo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BRW83_2222 (ahpF)
Enzymes [BR:ofo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BRW83_2222 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA K_oxygenase FAD_oxidored FAD_binding_2 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ARQ46954
LinkDB All DBs
Position
2391856..2393403
Genome map
AA seq 515 aa AA seqDB search
MLDNQVKEQLKNYLAKLVNPIEIVASINDTEKSREMTALLQDIAELSTKITLIEKADDDR
RSPSFSINRPDGGVNLRFAGIPMGHEFTSLVLALLQVGGYPPKVEPDVIEQIKNLDGKYE
FETYISLSCQNCPEVVQALNLMAVLNPNISHVMIDGSIYQDEVNERHIMAVPSIYMNGQE
FGQGRMNIKEILAKVDTGSSRREAEKISAKEPFDVLVIGGGSAAATSAIYAARKGIRTGL
VTENFGGQILNTTDIENVIAIKKIEGTHLAAVFEDNIRNHDIDVMMPQLAVNLIPGELIE
VQLASGASVKSKTVILATGANWRKMDVPGEEQYIGRGVAFCPHCDGPLYKNKRIAVIGGG
NSAVEAAIDLAGIAEHVSVLVRNTTLTADTVLQNKLFTLKNVTLITQALTSEVKGNGQKV
TGLVYEDMATVSKRTLDVEGIFVQIGQVPTTEWLKKTPVKLNEKNEIDVDAYNRTNVPGI
FAAGDVSSSPYKQIVIAMGDGAKAALSAFDYLIRN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaatcaagtcaaagaacaattaaaaaactatctcgccaaactggtcaatccg
attgagatagtcgcctcgattaacgataccgaaaaatccagggaaatgaccgctctgttg
caggacatcgcggagctttccaccaaaatcacccttatcgaaaaagccgacgacgacagg
agatcaccttctttctccatcaatcgtcctgacggcggcgtcaatcttcgctttgccggt
attccgatgggtcacgaattcacgtctttagttctcgcattgctgcaggttggcggttat
ccgcccaaagtcgaaccggacgttatcgaacaaatcaaaaatctggacggaaagtacgaa
ttcgaaacgtacatttccctgagctgccagaactgtcctgaagtcgttcaggcattgaac
ctgatggctgtgcttaaccccaatatttcgcacgtcatgatcgacggctccatctatcag
gatgaagtcaatgaacgtcatatcatggccgtacccagtatttatatgaacggtcaggaa
ttcggtcagggccggatgaacatcaaggaaattctggccaaggtcgataccggcagttcc
agacgcgaagctgaaaaaatatcggccaaagaacctttcgacgttctcgtcatcggcggt
ggctccgccgcagcgacgtcggccatttatgccgccagaaaaggtatccgtaccggactg
gtcactgaaaatttcggcggacagattctgaatacgaccgatatcgaaaatgtcattgcc
atcaagaaaatcgaaggcacccatctggctgccgtatttgaagacaatatccgcaatcac
gacattgacgtgatgatgcctcaactggccgtcaacctgattcccggcgagctgattgaa
gtacagctggctagcggtgcatccgtcaaaagcaaaaccgtcattctggcaactggtgca
aactggagaaaaatggatgttccgggagaagaacagtatatcgggcgcggggtagcgttc
tgccctcactgcgacggcccgctttacaaaaacaagcgtattgccgttatcggaggcggt
aactccgctgtcgaagccgccatcgatctggccggtattgccgaacatgtcagcgttctc
gttcgcaatacgacactgacggccgacaccgttttgcaaaacaagctgttcacactgaaa
aacgtgactttgatcacgcaggccctgacttccgaagtgaaaggaaacggccagaaagta
accggactggtctatgaagacatggctactgtttcgaaacggactctcgacgtggaagga
attttcgtccagatcgggcaggttccgacaaccgaatggctgaagaaaacacccgtcaaa
ctcaatgagaaaaacgaaatcgatgtcgatgcttataacaggacaaacgttcccggcatt
tttgcggcaggtgacgtcagctcgtctccctacaaacagattgtcattgcgatgggcgat
ggcgccaaggcagctctctccgcattcgattatctgattcgcaattaa

DBGET integrated database retrieval system