KEGG   Owenweeksia hongkongensis: Oweho_1809Help
Entry
Oweho_1809        CDS       T01677                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00380  Tryptophan metabolism
oho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Oweho_1809
Enzymes [BR:oho01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Oweho_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEV32789
UniProt: G8R174
LinkDB All DBs
Position
complement(1983209..1984489)
Genome map
AA seq 426 aa AA seqDB search
MEYQFNAEFALKCDAEDELKNFRAQFLFPQHKGENAIYFTGNSLGLQAKNAREYISEELD
DWATFGVEGHTESRRPWLKYHEFFTKPLASIVGAKPSEVVAMNGLTTNLHLLMVSFFRPE
GKRKKIVCEGKAFPSDQYALRSQLRFHGLTEDDLIEIQPDPVAELITDDRVIETLEKHAD
EIALVMLGGMNYYTGQFFDMERITRKGKEIGAVVGWDLAHAAGNMPIKLHDWDVDFAAWC
GYKYLNSGPGGVSGIFVHEKHHGQTEIPRFEGWWGHDKETRFKMPETFKPIPTAEAWQLS
NAPVFAMVPLLASLELFEQAGMQRLREKSKKLTAYLQFVVEQVRESTGVELKIITPKDPE
RRGAQLSVIVPGVGRKVFDYLMENGVISDWREPDVIRMAPVPMYNNFEDIFRFGKIFEQG
LKKFAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcagtttaatgcagagtttgcgctcaaatgtgatgcggaggatgaattgaaa
aatttcagagctcaatttttatttccacagcacaagggcgaaaacgccatatattttacc
ggaaactctcttggcttacaagccaaaaatgcacgcgagtatatcagtgaagagctggat
gactgggcgacatttggagtagaaggacacaccgaaagccgcagaccatggctgaagtat
cacgaatttttcacaaaacctttggcgagcatcgttggtgcgaaacctagcgaagtagtt
gctatgaatggccttaccacaaacttgcacttattgatggtgagcttttttcgcccggaa
gggaaaaggaaaaaaatagtttgcgaaggcaaggcttttccatcagatcaatatgcactt
cgcagccagttgcgttttcatggccttacggaagatgatcttatcgaaattcaaccggat
cctgtagctgaattaatcacagatgatcgcgtgattgaaaccttggaaaagcatgctgat
gaaattgctttggtgatgctgggtggtatgaattattacaccggtcagttttttgacatg
gagcgcatcacccgtaagggaaaggaaattggcgcggtagtaggctgggatttggcccac
gctgcgggaaatatgcccatcaaacttcacgactgggatgttgactttgccgcttggtgc
ggatacaaatatttgaatagtggtcctggtggggtgagcggaatatttgttcacgaaaaa
catcacggccaaaccgaaataccacgctttgaaggctggtggggacatgataaggagacg
cgttttaaaatgccggaaacctttaagcctatcccaacggctgaagcttggcagctgagc
aatgctcctgtttttgccatggttccacttttggcgagcctagagctttttgagcaggcg
ggtatgcaacgcttgcgcgaaaagtctaaaaagctgacggcttatctgcagtttgtggta
gagcaggttcgtgaaagcacaggcgtagaattgaaaattattaccccaaaagatccggaa
agaagaggtgctcagctatcggtgatagtgccgggtgttggtcgtaaggtgtttgactat
ttgatggaaaatggtgtgatttcggattggcgtgagccggatgtaatccgcatggctccg
gtgccgatgtacaacaactttgaggacattttccgcttcgggaaaatctttgagcaagga
ctaaagaaatttgccaaatag

DBGET integrated database retrieval system