KEGG   Owenweeksia hongkongensis: Oweho_1955Help
Entry
Oweho_1955        CDS       T01677                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00240  Pyrimidine metabolism
oho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Oweho_1955
Enzymes [BR:oho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Oweho_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEV32934
UniProt: G8R2E4
LinkDB All DBs
Position
complement(2149422..2150015)
Genome map
AA seq 197 aa AA seqDB search
MFLENPVNQHKHTGWMEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPMVDTRYAEED
VVSHDKNAIRCTPVENSSNLLLLGDGVDVIGIDEAQFFDDGIVEVCNELANRGSRVIVAG
LDMDFKGKPFGPMPNLMATAEYVTKVHAVCVRTGNLANYSHRKTTNEKQVMLGEHLEYEP
LSRAAFNELLAEEKKQK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaaccccgtaaaccagcacaaacacaccggatggatggaagtgatttgt
ggttcaatgtttagcggaaaaactgaagagttgattcgcagactaaagcgtgcgcaattt
gccaaacaaaaggtggaaatctttaaacccatggtggacacccgctacgcggaagaggat
gtggtaagccatgataaaaatgccattcgctgtactccggtagaaaatagttccaacctt
ctccttttgggcgatggtgtggatgtgattggaattgatgaagcgcaattttttgatgat
ggtattgtggaggtttgcaatgaattggccaatcgtggttcgcgtgttattgtagccggc
ttggatatggattttaagggaaaaccttttggccccatgcccaaccttatggctacggcc
gaatatgtaaccaaggttcatgcagtatgcgttcgcacaggaaatcttgccaactattct
catcgaaagactactaatgaaaagcaggtaatgcttggcgaacacttagaatacgagccg
ctgagccgggcagcttttaatgaattgttagcggaggagaagaaacagaaatag

DBGET integrated database retrieval system