KEGG   Owenweeksia hongkongensis: Oweho_2331Help
Entry
Oweho_2331        CDS       T01677                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oho  Owenweeksia hongkongensis
Pathway
oho00010  Glycolysis / Gluconeogenesis
oho00053  Ascorbate and aldarate metabolism
oho00071  Fatty acid degradation
oho00280  Valine, leucine and isoleucine degradation
oho00310  Lysine degradation
oho00330  Arginine and proline metabolism
oho00340  Histidine metabolism
oho00380  Tryptophan metabolism
oho00410  beta-Alanine metabolism
oho00561  Glycerolipid metabolism
oho00620  Pyruvate metabolism
oho00625  Chloroalkane and chloroalkene degradation
oho01100  Metabolic pathways
oho01110  Biosynthesis of secondary metabolites
oho01120  Microbial metabolism in diverse environments
oho01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oweho_2331
   00053 Ascorbate and aldarate metabolism
    Oweho_2331
   00620 Pyruvate metabolism
    Oweho_2331
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Oweho_2331
   00561 Glycerolipid metabolism
    Oweho_2331
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Oweho_2331
   00310 Lysine degradation
    Oweho_2331
   00330 Arginine and proline metabolism
    Oweho_2331
   00340 Histidine metabolism
    Oweho_2331
   00380 Tryptophan metabolism
    Oweho_2331
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Oweho_2331
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Oweho_2331
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Oweho_2331
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Oweho_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEV33303
UniProt: G8R683
LinkDB All DBs
Position
2609155..2610693
Genome map
AA seq 512 aa AA seqDB search
MSDFKIEDILNELGVKAENSGTSTGQKNFGSGEVIESKSPVDGKLIAKVTTTTKEEYDEV
IKTSQEAFKTWRMMPAPQRGEIVRQFGDKLREKKDALGKLVSYEMGKSLQEGWGEVQEMI
DICDFAVGLSRQLYGLTMHSERPKHRMYEQWHPMGTVGIISAFNFPVAVWSWNTALAWAC
GDVCVWKPSEKTPITGVACQNIMAEVLKENNLPEGISCLINGGREIGEYMSNDGRIPLVS
ATGSTRMGREVGTAVAKRLGKSLLELGGNNAIIITENADLDATLVGAVFGAVGTAGQRCT
STRRLIIHESMYDEVKTKLKKAYSQLRIGDPLDMNNHVGPLIDTMAADMYEDAIKKAKEE
GGTVLVEGGRLEGAGYESGCYVKPCIIEVESHYKIVCTETFAPILYIMKYKDLDEAIAIQ
NNVPQGLSSAIMTTNMRESERFLSAEGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRES
GSDAWKAYMRRQTNTINYSTEVPLAQGIKFDL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattttaagatagaagatatattaaatgaacttggtgtaaaagccgagaattca
ggaacatcaaccggtcagaagaattttggaagtggtgaagttatcgaatcaaaatcacca
gtagatggcaagctgatagctaaggttactaccactacaaaggaagaatatgatgaggta
atcaaaacttcacaagaggcttttaaaacttggagaatgatgccagctcctcaacgtggc
gaaatagttcgtcagtttggagataagctacgtgagaaaaaagatgcccttggaaaactt
gtttcctatgaaatgggaaaatccctgcaagaaggctggggagaagttcaggagatgatc
gatatctgtgactttgcagtagggcttagccgccaactttatgggcttaccatgcactcg
gagcgtcctaagcacagaatgtacgagcaatggcacccaatgggaacagtaggaattatt
tctgcatttaacttccctgtggctgtttggagctggaacacggcactagcttgggcctgt
ggcgatgtttgcgtttggaaaccatccgagaaaactccaattacaggtgttgcctgccaa
aatataatggccgaggtacttaaagaaaacaatcttccggaaggaatttcctgtcttata
aatggtggtcgcgagattggagagtacatgagtaatgatggaaggattcctttggtatca
gccaccggtagcacccgtatggggcgcgaagtaggtacagctgtagctaaaagactagga
aaatctctgttggaattaggtggaaacaatgccatcatcattaccgaaaatgctgattta
gatgcaactttggtaggagccgtatttggggctgtaggtacagctggtcagcgttgtact
tctacacgtagattaatcatccatgaaagcatgtacgatgaagtaaagacaaaactgaag
aaagcttatagccaattgcgcattggtgatcctctggatatgaataatcacgtaggtcca
cttattgacaccatggcggctgatatgtatgaagatgcaatcaagaaagcaaaggaagaa
ggtggaaccgtgcttgtagaaggtggtcgattagaaggtgcaggatacgaaagtggctgc
tatgtgaagccttgcatcattgaagtggaaagccattacaaaattgtttgtactgagact
tttgctccaattttgtacatcatgaaatacaaagatttggatgaagcaattgccattcaa
aacaatgtaccgcaaggattatcatctgcaataatgactaccaatatgcgtgagtcagaa
agattcctttcggcagaaggtagcgattgcggaattgcaaacgtaaacattggtactagc
ggtgctgaaattggcggtgcttttggtggcgaaaaagaaactggcggtggacgcgaatct
ggctctgatgcctggaaagcctacatgaggcgtcagacaaatacaatcaactattctacg
gaagtgccactagcacaaggtatcaagtttgatttgtag

DBGET integrated database retrieval system