KEGG   Owenweeksia hongkongensis: Oweho_2424Help
Entry
Oweho_2424        CDS       T01677                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oho  Owenweeksia hongkongensis
Brite
Enzymes [BR:oho01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Oweho_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Lip_prot_lig_C
Motif
Other DBs
NCBI-ProteinID: AEV33394
UniProt: G8R729
LinkDB All DBs
Position
complement(2700852..2701460)
Genome map
AA seq 202 aa AA seqDB search
MSFELPDLPYSKSALEPYIDAQTMEIHHDKHHAGYTTKLNDAIEGTELEKQSIEDILKNV
SKHSGGVRNNGGGYYNHSLFWSIMGPDAGGDPTGDVGAAIDDAFGSYENFKTEFSNAAAT
RFGSGWAWLIVNGEGKLEVTSSPNQDNPLMDVAEKKGTPILGLDVWEHAYYLKYQNKRPD
YISAFFNVINWDEVNRRFAEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaacttccagatctaccttattctaagtcagcattagaaccatatattgat
gctcaaaccatggaaattcaccatgataaacatcacgctggatacactaccaaattgaat
gatgcaattgaaggcactgagcttgaaaagcagtcaatcgaggatatcctaaaaaatgtt
tctaagcattcaggtggtgtgcgcaacaatggtggtggatattataaccatagcttgttc
tggagcatcatgggccctgatgctggtggcgaccctactggtgatgtaggtgctgcaatt
gacgatgcttttggttcttacgaaaactttaaaactgaatttagcaatgcagccgctacc
cgttttggctcaggttgggcttggcttatcgtaaatggtgaaggaaaacttgaggttact
tcttctccaaatcaagataacccattgatggatgttgctgagaaaaaaggaactccaatc
ttgggtcttgacgtgtgggaacacgcatactacttaaagtatcagaacaaacgtccggat
tatatctctgcattttttaatgtgataaactgggatgaagtaaatcgcagatttgctgaa
gcgaaatag

DBGET integrated database retrieval system