KEGG   Oceanobacillus iheyensis: OB0853Help
Entry
OB0853            CDS       T00093                                 

Definition
(GenBank) hypothetical conserved protein
Organism
oih  Oceanobacillus iheyensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1 GtrA
Motif
Other DBs
NCBI-ProteinID: BAC12809
JAMSTEC: OB0853
UniProt: Q8CVA4
LinkDB All DBs
Position
904337..904570
Genome map
AA seq 77 aa AA seqDB search
MDKGTIIRTIVLVLALTNQFLITAGYHPIPGTQELWGEILSSIFTIVATLTAWFKNNYVT
YKGKKQHQVLVEHQLAK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaggaacgattattcgaactatcgtacttgttctagctttaacgaatcagttt
ttgatcactgctggataccatcccatacctggaacacaagagctctggggagaaatcctt
tcatctatttttactattgtagctaccttaacagcttggttcaaaaataattatgtgaca
tacaaaggcaaaaaacaacatcaagtacttgtggaacatcaattagcaaaataa

DBGET integrated database retrieval system