KEGG   Oceanobacillus iheyensis: OB1509Help
Entry
OB1509            CDS       T00093                                 

Definition
(GenBank) serine:threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oih  Oceanobacillus iheyensis
Brite
KEGG Orthology (KO) [BR:oih00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oih01001]
    OB1509
Enzymes [BR:oih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     OB1509
Protein kinases [BR:oih01001]
 Serine/threonine kinases: Other
  Bacterial family
   OB1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo DUF2207 Haspin_kinase Pkinase_fungal DUF4181 Ni_hydr_CYTB CrgA Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID: BAC13465
JAMSTEC: OB1509
UniProt: Q8ER22
LinkDB All DBs
Position
1552935..1555001
Genome map
AA seq 688 aa AA seqDB search
MNKGELLNERYKIIKKIGGGGMANVYLARDTILERDVAVKALRMEYIHDQEFIARFDREA
QSATSLSHPNIVNIFDVGEEDQLLYMVMEYVDGMTLKEYIHQHGPIDVPEALDIMKQLTS
AIAHAHANEIVHRDIKPQNILINSTGQAKVTDFGIAMALSATALTQTNSILGSVHYLSPE
QARGGMATKKSDIYSMGIVLYELLTGKLPFSGQSPVSIALKHLQNNTPSVKKANPSIPQS
VENIVLQATAKDPFHRYNNIYELEEALETALDPNRLDEEPFSLPEEVGDETKAIPIITDQ
DNVVDNNNEDTIIHATNQGTKNYPEEPHAKDNKKKKKGKVKKEQKKSKNKKPKSKKKKVF
WIVFSILLLALLVTGITVFATQPKDIPMPDVIEMDSADAKQTLEESNLEVEEEEVFSDEI
ENGLVVRTDPNAGRTVKEGSTVTMFVSQGQERVEMEDYEGQDFEQVKELLEEEGFTDITS
YEKSSEAPVGEIISQIQPEAGSEVVPGETKVIFEISSGPELVSLNNLTGMSKEEVQDYID
RNELTMNSHEEYSDNVDEGRVIRQEPPSGTDLEKGSTVDVYFSMGPEEIPPRSHTVSFTV
NYEPQEEEGSENEDGNEEEQQPVEQIVRVYIGDVNNEISDVYEERAITEDEEFTFTLMVP
PDSEAEYKVTRDDEVIKERSVSYEGEED
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaggagaactgctgaatgaacgctataagataattaagaagattggcggaggc
ggaatggccaacgtctatcttgcccgagatacaatactagaacgtgatgtagctgtaaaa
gcattacgaatggaatatatacatgaccaagagtttatcgctcgctttgatcgtgaagca
caatcagcgacgagcttatctcaccctaatattgtaaatatattcgatgtaggggaagaa
gatcaattattgtatatggttatggaatatgtcgatggaatgactttaaaagaatacata
catcaacatggaccaattgatgttccagaagcattagatattatgaagcaattaacttct
gcaatagcacatgcacatgcaaatgaaattgttcatcgtgatataaaaccacaaaatatt
ttaattaatagtaccggacaagccaaagtgacagattttggtatcgcaatggcgttaagt
gctacggctctgacacaaactaattctattttaggttctgtgcattatctttctccagaa
caagctcgtggaggaatggcaacaaaaaaatcggatatatattccatgggtattgtctta
tatgaactattaacaggaaaattacctttttcaggacaatcgcctgtgtcgatagctctt
aagcatttgcagaataatacaccttctgtaaaaaaagcaaatccatccattccccaaagt
gtggaaaatattgttttacaggcaacagccaaagatccattccatcgctataataatatt
tatgaattagaagaggcattagaaactgcattggatcctaatcgattagatgaagaacca
ttttcattaccagaggaagtcggcgacgaaacaaaagcgattccaatcattactgatcaa
gataatgtagtcgataataataatgaagataccattattcatgcgacaaatcagggtaca
aaaaattatccagaagaaccgcacgcgaaagataataaaaagaagaaaaaaggaaaagtg
aaaaaagaacagaagaaatccaagaataaaaaacctaaatcaaagaagaaaaaagttttt
tggattgtattttcaattctgcttttagcccttctagtaactggtattacggtatttgct
acacaaccaaaagatattccaatgccagatgtcattgagatggattctgcagatgcgaaa
cagacactagaagagagcaatttagaggtagaagaagaggaagtattctcagatgaaatc
gaaaatgggcttgttgtacgtactgacccgaatgctggaagaacggttaaggaaggctca
acagttaccatgtttgtaagtcaaggacaagaacgtgtagaaatggaagattatgaaggt
caggactttgaacaagtaaaagaattattagaagaagaaggatttacggatattacctct
tatgaaaaatcatctgaagcgccagtaggagagattatttcacaaatacaaccagaagcg
ggaagtgaagttgttcctggggaaacaaaggtgatttttgagataagctctggtccagaa
ctggttagtttaaataatctaactggcatgtcaaaggaagaagttcaggattatatcgat
cggaatgaattgacgatgaattctcatgaagaatactcagacaacgtggatgaaggaaga
gtgataagacaagagccaccttctggtactgatttagagaaaggttcaactgttgatgta
tatttctctatgggtccagaggaaatacctcctcgttctcacacggtctctttcaccgta
aattatgagcctcaggaagaagaaggttcggagaatgaagatggtaatgaggaagagcag
cagcctgtagaacaaattgttcgagtgtatattggtgatgtcaataatgaaatttcggat
gtttacgaagaaagagcgattacagaggatgaagaattcacctttactttaatggttccg
cctgattcagaggcagagtataaagttacgagagatgatgaggttataaaagaacgaagt
gtttcatatgaaggagaagaagattag

DBGET integrated database retrieval system