KEGG   Oceanobacillus iheyensis: OB2707Help
Entry
OB2707            CDS       T00093                                 

Definition
(GenBank) benzaldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00627  Aminobenzoate degradation
oih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oih00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    OB2707
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     OB2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAC14663
JAMSTEC: OB2707
UniProt: Q8EMY3
LinkDB All DBs
Position
complement(2776442..2777902)
Genome map
AA seq 486 aa AA seqDB search
MSMYSQLDSQYINGVWKDGNGKATIQNTNPYSGEVIATYRAASLQDLDDAYETAQEVQKA
WAKENPITVQRIMDKAVTYMEENHEEIVDIIIQEIGGTRLKAEFEIGLVTNMIKEASSFP
MRMSGSILPSPIDGKENRVYRVPVGVVGVISPFNFPFFLSMKSVAPALATGNAVVLKPHE
HTAITGGTMIAKIFEEAGLPKGVLQVVTTEISEIGDRFVDHPVPAAISFTGSTKVGKHIG
EVASRNLKEVHLELGGNSALIVLEDADVDYAVSAGVFSRFTHQGQICMSANRIIVHEDVY
DEFVQKYADKVKTLTCGDPADSSTIIGPLINERQVQNTVNLIEKGVEEGAHPLVRGQVNG
NVVEPVIFTEVTPDMQIANEEFFAPVVAIMKVSSEEQAIAYANASSYGLSGAVHTSDVNR
GAEVAKQLESGMIHINDGTINDEPNVAFGGVKNSGVGRLNGEWSLEAFTTTKWISIQHTK
RQFPYS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgtatagtcaattagattcccaatatatcaatggtgtttggaaagatggaaat
ggaaaggctacgattcaaaatacgaatccatatagtggagaggttattgctacttaccgt
gcagcttcattacaagatttagatgatgcgtatgaaacagcacaagaagtacaaaaagct
tgggctaaggaaaatccgattactgtacaaagaattatggacaaagctgttacttatatg
gaagaaaatcatgaagaaatagttgatattatcattcaagaaataggcggaacccgtctg
aaggctgaatttgaaatcggacttgttacaaatatgattaaggaagcatcctcttttcca
atgcgaatgagcggaagtatcttaccttcacctattgatgggaaagaaaatcgtgtttat
cgagtaccagttggagttgtaggtgtgattagtccatttaacttcccattcttcctatct
atgaaatctgttgctcctgccttagctactggtaatgcagttgtattaaaaccacatgaa
catacagcaattacaggtgggacaatgattgcaaaaatatttgaagaagctgggcttcct
aaaggggtacttcaagtagtaacaacagagatttcagaaattggtgatcgttttgttgat
catcccgttccagctgcgatttcctttaccggttctacaaaggtagggaagcatattggt
gaagttgcttctcgtaatctaaaagaagttcatctagagctaggtggaaacagcgcatta
atcgtactagaagatgcagatgttgattatgcagtaagtgctggtgtatttagtagattt
acacatcaaggccaaatttgtatgtcagcaaatcgaattattgttcatgaagatgtgtat
gatgaatttgtccagaagtatgcagataaagttaagactttgacttgcggtgaccctgca
gattcaagtacgatcatcggtccattaattaatgagcgtcaagtgcaaaatacagttaac
cttatagaaaaaggggtggaagaaggcgcacatccattagtaagaggacaggtaaatggt
aatgtagtagagcctgtcatctttacagaagtaactccagatatgcaaattgccaatgaa
gaattctttgcgccagttgtcgcgattatgaaagtatcatcagaagagcaagccattgct
tatgcaaatgctagttcatatggtcttagtggtgccgtgcatacaagcgatgttaatcgt
ggtgcagaagtggcaaaacaattagagtcaggtatgatccatattaatgatggaacaatt
aatgacgagccaaatgtagcatttggaggagtgaaaaattccggcgtaggtcgtctaaat
ggagagtggagtttagaagcatttacaacaacaaaatggatttctattcaacatacaaaa
cgccaattcccatattcctaa

DBGET integrated database retrieval system