KEGG   Oryzias latipes (Japanese medaka): 100049212
Entry
100049212         CDS       T02443                                 

Gene name
ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100049212 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100049212 (ccnb1)
   04114 Oocyte meiosis
    100049212 (ccnb1)
   04115 p53 signaling pathway
    100049212 (ccnb1)
   04218 Cellular senescence
    100049212 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100049212 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    100049212 (ccnb1)
   03036 Chromosome and associated proteins [BR:ola03036]
    100049212 (ccnb1)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100049212 (ccnb1)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100049212 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N TPX2
Other DBs
NCBI-GeneID: 100049212
NCBI-ProteinID: NP_001098137
UniProt: Q9IBG1
LinkDB
Position
12
AA seq 306 aa
MALRVTRNRLASTRAELGGKTCSVAGPTQKPRAALGEIGNVAVINKDVTKKTIKTEVAKK
TKIPAKAEKIELPKAAVVPVKPAPEVQVTEVPDQAEPASPTPMETSGCESADLCQAFSDV
ILNTAIRDVDADDYDNPMLCSEYVKDIYKYLRQLEMEHSVKPNYLEGQEITGNMRAILID
WLVQVGLKFRLLQETMYMTVGIIDRFLQDHPVPKKQLQLVGVTAMFLASKYEEMYPPEIS
DFAYVTDRAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIYEVWRGVGAANCSLP
PLHVLR
NT seq 921 nt   +upstreamnt  +downstreamnt
atggctctgagagttaccaggaaccgactggcctccacccgggccgaactgggcggaaag
acgtgctcggtggccgggcctacacagaagccccgcgcggccctcggagaaatcggaaac
gtcgcagttattaacaaagatgtcacgaaaaagactatcaagacggaggttgctaagaag
acaaagatcccagctaaagctgagaagatcgagctaccaaaagctgctgtggtccctgtt
aaaccagcacctgaagtgcaggtgactgaggtgccagaccaggctgaacctgcatccccc
acccccatggagacctctggatgtgagtctgctgacctctgtcaagcattttcagatgtc
atcctcaacacggccatcagggacgtggatgcagatgactacgacaaccccatgctctgc
agtgaatatgttaaggacatctacaagtacctccgtcagcttgagatggagcacagcgta
aagccaaactaccttgagggtcaggagatcaccggaaacatgcgagccatcctcattgac
tggctggtacaagtgggcctcaagttccgtctgctgcaggagaccatgtacatgactgtg
ggaataatcgaccgctttcttcaggaccatccagtccccaagaagcagctgcagctggtt
ggcgtgaccgccatgttcctggcctccaaatacgaggagatgtaccctccggagatctca
gactttgcctacgtgacggacagggcttacaccactgctcagatcagagacatggaaatg
actattctgcgagtgctgaagtttcagctgggccgccccctcccgctgcagttcctcaga
agggcctccaagatctatgaggtgtggcgcggtgtcggtgcggcaaactgttctcttcca
ccactgcatgtgctgaggtga

KEGG   Oryzias latipes (Japanese medaka): 100049213
Entry
100049213         CDS       T02443                                 

Gene name
ccnb2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100049213 (ccnb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100049213 (ccnb2)
   04114 Oocyte meiosis
    100049213 (ccnb2)
   04115 p53 signaling pathway
    100049213 (ccnb2)
   04218 Cellular senescence
    100049213 (ccnb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100049213 (ccnb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    100049213 (ccnb2)
   03036 Chromosome and associated proteins [BR:ola03036]
    100049213 (ccnb2)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100049213 (ccnb2)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100049213 (ccnb2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA
Other DBs
NCBI-GeneID: 100049213
NCBI-ProteinID: NP_001098138
UniProt: Q9IBG0
LinkDB
Position
3
AA seq 359 aa
MSSVEIVAQQLLAAEHPRRMGKGAAADPRRAALGELTNLNAAAATNGTGAAASAPVLAKP
SVKEEQELCQAFSEVLLAVQDVDEQDADQPQLCSQYVKDIYKYLHILEEQQPVRANYMQG
YEVTERMRALLVDWLVQVHSRFQLLQETLYLTVAILDRFLQVHPVSRRKLQLVGVTAMLV
ACKYEEMYAPEVGDFAYITDNAFTKSQIVEMEQVILRSLSFQLGRPLPLHFLRRATKVAG
ADVEKHTLAKYLMELTLLDYHMVHYRPSEVAAAALCLSQLLLDGLPWSLTQQQYSTYEEQ
HLKPIMQHMAKNVVLVNEGRTKFLAVKKKYSSSKLMKISLIPQLNSSTVKTMADALHDP
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcgtctgtggaaattgttgcgcagcagctcctggccgcagagcaccctcggaggatg
gggaaaggagctgcagcggatcccaggagagctgctttgggggaactgaccaacttgaac
gcagctgcagccaccaacgggacgggtgcggctgcctcagctcccgtcttagctaaaccc
agcgtgaaggaggagcaggagctctgccaggctttctcggaggtgctgctcgctgtgcag
gacgtggacgagcaggatgcagaccagcctcagttatgctcccaatatgtcaaggacatc
tacaagtatctgcacatcctggaggagcagcagcctgtgcgtgccaactacatgcaaggc
tacgaagtcactgagcgcatgagggcactcctcgttgactggcttgtccaagtccactcc
aggttccagctgctgcaggagaccctgtacctcactgtggccatcctggaccgcttcctg
caggtccacccggtgagccgtcggaagctgcagctcgtcggcgtcacagccatgctggtg
gcttgcaagtatgaggagatgtacgctcctgaagtgggggactttgcctacatcacagac
aacgccttcacaaaatctcagattgtggagatggagcaagtgatcctcaggagcctcagc
ttccagctgggccgccccctcccgctccacttcctcaggcgagccaccaaagttgccggc
gctgacgtggagaagcacactctggcaaagtacctgatggagctgaccctcctggactac
cacatggtgcattaccggccctctgaggttgctgctgcagcgctgtgtctgtctcagctg
ctgctcgatgggctgccatggtcgctcacacagcagcagtattccacctacgaagagcag
catctaaaacccatcatgcagcacatggccaagaacgtggtgctggtgaacgagggcaga
acaaagttcctggcggtgaagaagaagtactccagcagcaaactgatgaagatcagcctc
attcctcagctcaactcttcaacagtcaagaccatggcggatgctctgcacgatccctga

KEGG   Oryzias latipes (Japanese medaka): 101162061
Entry
101162061         CDS       T02443                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101162061
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101162061
   04114 Oocyte meiosis
    101162061
   04115 p53 signaling pathway
    101162061
   04218 Cellular senescence
    101162061
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101162061
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101162061
   03036 Chromosome and associated proteins [BR:ola03036]
    101162061
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    101162061
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101162061
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF4141
Other DBs
NCBI-GeneID: 101162061
NCBI-ProteinID: XP_004075918
UniProt: H2MGJ4
LinkDB
Position
13
AA seq 411 aa
MARTGFCDSKPLLDLHKKADERRVPLRARANACAPTDRRQPAETDESRMAPVKMETESRW
ERRLSAQTNESIILGFHVDSRASSAETVADECVEKPVLLYPHGLQGLHSLDALVPSLLRH
EVEMALEKLDLICDRTFAWDLFLDMMRTQTQNSFPNADLPRHFTDSTRAILVDWMVQVHE
LLHFQEDTLYLAIHLLNHSLRQLKVTTANLQLLGMVCLLIAAKKEESLLPEVSDLCSLMD
HAYTKRQLLRMERRLLCALKFDLSHSPPLHFLLLFAAVARCSAMMVWMARYLLELSLQEA
QCVVFLPAQLAGAALCLARHVLQESPTPEGEAAWCLTSSIHVGSQTILLRIMQILATAAS
RVQTHENSATFIKFSSPERMHVSRHPGLRNPAGLLGVCSSQAPLKGTKLHL
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggccaggactgggttctgcgactccaagcccctgttggacttacacaagaaggcggat
gaaaggagagtcccactgagggcccgggcgaacgcgtgcgcgccaacagaccggcggcag
cccgcagagacggacgagtccaggatggccccggttaaaatggaaacggagagcagatgg
gaaaggaggttgtcagctcaaacgaatgagagcatcatcctgggattccatgtggacagt
agggcgagctctgctgaaactgtggctgatgaatgtgttgagaagccggtgctgctttac
cctcatgggctgcagggtcttcacagcctggatgctctggttcccagcttactgcgtcat
gaggtggagatggcgcttgagaaactggacctcatttgtgacaggacttttgcctgggat
ttgtttttggacatgatgagaactcaaacgcagaactctttcccaaatgctgacctccct
cgtcatttcactgattctacccgagcaatcctggtggactggatggtacaagttcatgag
ctgctgcatttccaagaagacaccctgtatttggccattcacctcctcaaccactccctg
cgacagctcaaggtcaccacagcaaacttgcagctcctcggaatggtttgcctcttaatt
gcagcgaaaaaagaggagagcctcctcccagaggtgtctgatctctgcagcttaatggac
catgcctacacgaaacgccagctgctgcgaatggagcgccgactcctttgtgcgctgaag
tttgatctatctcacagcccccctttgcatttcctcctcctcttcgccgcggttgcccgc
tgcagcgccatgatggtgtggatggcccgctatctgctggagttgtctctccaagaggcc
cagtgtgtggtgtttctacccgcccagctggctggagcagccctctgcttggctcgccat
gttctccaggagtctccaacccctgaaggagaggctgcctggtgtctgacctccagcatc
catgttggcagtcaaaccattcttctaaggatcatgcagattctagccactgctgcttcc
agggtccagacccatgagaactctgctacttttattaagttctcctccccagagaggatg
catgttagcagacacccaggtctgaggaatcctgctggtctgttaggtgtatgctcttca
caagcccctcttaaaggaaccaaattacacttgtga

DBGET integrated database retrieval system