KEGG   Oryzias latipes (Japanese medaka): 100049215
Entry
100049215         CDS       T02443                                 

Gene name
casp3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049215 (casp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100049215 (casp3)
   04115 p53 signaling pathway
    100049215 (casp3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100049215 (casp3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100049215 (casp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    100049215 (casp3)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100049215 (casp3)
Peptidases and inhibitors [BR:ola01002]
 Cysteine peptidases
  Family C14: caspase family
   100049215 (casp3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 100049215
NCBI-ProteinID: NP_001098140
UniProt: Q8JIS8 A0A3P9LGK4
LinkDB
Position
10
AA seq 290 aa
MVMAESAEELSGKDQVDTNPVISKRSPANQPNPRSTDVCVKKQDADPYRYSMDYPKMGIC
LIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQD
HSKFASFACVILSHGEEGVIYGTDGPVSFNKLIECLKGRSCLSLVGKPKLFFIQACRGML
FDEGIEHDAKDDTSEKIPLEADFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKTL
DLMQIMTRVNHKVATHFESSSNAPGFSGKKQIPCIVSMLTKDFYFPYESN
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatggctgaatctgctgaagagctctcaggcaaggaccaggtggacaccaaccct
gtgattagcaagaggtcccctgctaatcagccaaatcccaggtctactgatgtctgcgtc
aaaaaacaagacgccgacccttaccgctacagcatggactaccccaaaatgggaatctgc
ttgattatcaacaacaaaaactttcacaaagattccgggatgggtcctcgtaacggtaca
gacaatgacgctgctgctgcttggaagtcttttatgaagctgggctacgaaatccaaatg
tacaacgaccagaccgtggatcagatgaaaaagctgtttcgccaaatgtccaaccaagac
cacagtaagtttgcctcctttgcctgtgtgattctcagtcacggagaggagggcgtgata
tacggcactgatggtccggtatcgttcaacaagctcatagaatgcttgaaaggacgaagc
tgtttgagtcttgtggggaaaccaaagctcttcttcatacaggcgtgccgtggcatgctc
ttcgatgagggcatagagcacgatgccaaagacgatacatcagagaagattcccctggag
gccgacttcctgttcgcctactccaccgtttcaggctattactcatggaggagcaccgcc
aacgggtcctggttcatccagtctctgtgtgagatgctggagaagttcagtaaaacactg
gacctgatgcagattatgactcgagtgaaccacaaggtggcgacgcacttcgagtcttct
tccaacgcgcctggatttagcggcaaaaagcagatcccttgcattgtctccatgttgacc
aaggacttttactttccttacgagtccaattaa

KEGG   Oryzias latipes (Japanese medaka): 100049265
Entry
100049265         CDS       T02443                                 

Definition
(RefSeq) caspase 3B
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049265
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100049265
   04115 p53 signaling pathway
    100049265
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100049265
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100049265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    100049265
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100049265
Peptidases and inhibitors [BR:ola01002]
 Cysteine peptidases
  Family C14: caspase family
   100049265
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 100049265
NCBI-ProteinID: NP_001098168
UniProt: Q8JIS9
LinkDB
Position
1
AA seq 280 aa
MASNRPGEDSTDARKDNGELAAGASPAPDRMDVDGKPSSHSFRYSLNFPTIGLCIIINNK
NFDRGTGMNQRNGTDIDAASAMKVFSKLGYRVKIYNDQTVKQIKQLLTDVSRMDHSDSAS
FVCILLSHGDEGVFFGTDGSIELKTLTSLFRGDHCKSLVGKPKLFFIQACRGTELDDGIE
ADSKEDTTKIPVEADFLYAFSTAPGYYSWRNTMTGSWFINSLCEMLSKYGKELELLHIMT
RVNHMVAVEFESISTLPGFHAKKQIPCIVSMLTKEMYFYP
NT seq 843 nt   +upstreamnt  +downstreamnt
atggcgtcaaatcgaccaggagaggattctacagacgcaaggaaagacaatggagaactg
gcagcaggggcttcacctgctcctgatcgcatggatgtcgatgggaagccctcctctcac
agctttagatacagcctcaactttcccaccatcggcctctgcatcatcattaacaacaag
aattttgatcgaggaaccggtatgaatcagcgaaacggtacagacatcgatgcagcctct
gcaatgaaagtgttttcaaagttgggctatagagtgaagatttacaatgaccagacagtt
aaacagattaaacagcttttgactgatgtatcaaggatggaccacagtgactccgcctct
ttcgtctgcatccttttgagtcatggcgacgagggcgttttcttcggcacggatggttcg
atagaactcaaaactctgacgtccctgttccgaggggatcactgcaaatcactggtggga
aagcccaaactgtttttcatccaggcttgcagaggcaccgaactggatgatggcattgaa
gcagattccaaagaagacaccaccaagatcccagtggaagctgacttcctgtacgcattc
tccacagctccaggctactactcatggagaaacaccatgactggatcttggttcatcaac
tctctgtgtgaaatgctcagtaaatatggcaaagaacttgagctcctgcacatcatgacc
agagttaaccacatggtggcggtagagtttgagtccatctccactttaccaggttttcat
gcaaagaaacaaatcccctgcatcgtgtcaatgctgaccaaagagatgtacttttatcct
tga

DBGET integrated database retrieval system