KEGG   Oryzias latipes (Japanese medaka): 100049280
Entry
100049280         CDS       T02443                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04020  Calcium signaling pathway
ola04144  Endocytosis
ola04510  Focal adhesion
ola04540  Gap junction
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049280 (pdgfra)
   04020 Calcium signaling pathway
    100049280 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100049280 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100049280 (pdgfra)
   04540 Gap junction
    100049280 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100049280 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    100049280 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ola04090]
    100049280 (pdgfra)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100049280 (pdgfra)
Protein kinases [BR:ola01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100049280 (pdgfra)
CD molecules [BR:ola04090]
 Proteins
  100049280 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 Ig_4 Herpes_gE C2-set_2
Other DBs
NCBI-GeneID: 100049280
NCBI-ProteinID: XP_004084821
UniProt: H2MZV1
LinkDB
Position
4
AA seq 1460 aa
MGGVRTFAVFKKFLVLLVLGTSAVARPTITPNLKELFLQPHSFLNLTCFGESKKVSWVKP
LPENSIVITGNNSATLLISRVTVGNTGFYVCNYEEQQDSEVDIYVFVTDPSNLFVPESPE
NIHLILSQHMVEIPCRVSHSNAHVILRRVPSGEPISSPYDAKIGFFGIDVPGQYQCESSV
NGHTVKSDIYIVTHEDSCRNFTLEVTATERTVRAGQPLNITCMALPGSNYKQEWVYPRTQ
AVNATHIREKFSDHASFTISIPKTRPQDTGIYECAVECLESGYVRSSNVAVTVFEESSFI
VLDHSGIFETEFISLLEETQFTILITAYPAPKITWMKDNNLIPESYYVFTQTSHFEGNRY
QSVLTLQQPLEKDSGNYTITALSGSHTAHFSFILVVKASSGAMFPPSTAPVLLPDKEELL
VPLHTPFTMTCRGQAKLEWDTPYNVPVRVQQDHSGLFVTTITVDWAEAYHTGSYKCFYSG
SNTEDSKSQSIYVFVPDPDVPFVPSLMPFSNHVLSDHEEMEIQCRVSDPSANVTLINLET
QEPVPSVYDSKRGALGVFLAGTYVCKALINGHEYYSEEYIVHGWPGGTALHVELKAKRTA
LLVGETITVTCLARGPEILEDNWKYPGKAANRGTKTVRENKKDQEILYTLTIPQASVKDS
GSYSCSIVDIANNEIQTKEQEIQVFAGEFVSIDPEFGEHESAELDEVREFRANVHSFPNA
RVTWIKDGILLSDVTAEISTSLRQTSETSYMSVLTLIRAKGEDSGNYTMRVENGNQSRHV
SLILEVKVPAVIVDLMDIHHGSAIGQSVVCITRGRPTPAVEWFICKSIKHCGNNSSFWVP
LATNSTDIVFDSHFEGNNLESQVVFGHLESTLAVRCLARNEMATVSREVKLVSSGPHPEL
TVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSR
WEFPRDRLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSEL
KIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFLSLSPEKNRKEM
DIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMNNASKYSDVQRSNYDHP
PSQKGSSECEMENLLSDDTTEGLTTTDLLSFTYQVAKGMEFLSSKNCVHRDLAARNVLLS
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPQDIYETMMKCWNSDPEKRPSFMGLS
ESVALLLPSSYRRHYERVNRDFLKSDHPAVTRVCMENDTDYVDIPYKNQGKLKERESGFD
EQRLSSDSGYIIPLPDLDPLSDEEYGKRNRHSSQTSEESAIETGSSSSTYPKREGETLED
ITLLDETCLDCSDLVEDSFL
NT seq 4383 nt   +upstreamnt  +downstreamnt
atgggtggggtgagaacatttgctgtgtttaagaaattcctggtgctgctggttctaggc
acctctgcagttgcaagaccaaccatcaccccaaacctaaaggaactttttctacaacct
cactctttcctcaacttgacctgctttggggagagtaaaaaagtctcctgggtcaagccc
ctgccagaaaactccatagtcattacagggaacaactcagccactctgctcatttccaga
gtcactgtggggaacacaggcttttatgtgtgcaattatgaagagcagcaagatagtgaa
gttgacatttatgtctttgttacagatcccagcaacctgtttgtccccgagtctccagaa
aacattcatctcatcctctcccaacacatggtggaaatcccgtgccgtgtatctcactcg
aacgctcacgtcatcctgaggagggtgcccagtggagagccgatttcctctccctacgat
gcaaagataggcttttttgggattgatgttcctgggcagtaccagtgtgaaagttctgtc
aatggccacactgtaaagagtgacatttacatcgtgacccatgaagacagttgcagaaac
ttcacactggaagttacagccactgagaggacagtgagagctggccagcctctcaatatc
acatgcatggccctgcctggctccaactacaagcaggagtgggtctatccaaggacacag
gctgtgaatgccactcacataagggaaaaattctctgaccatgccagcttcaccatcagt
atcccaaaaaccaggcctcaggacactggcatctacgagtgcgctgtagagtgcctggaa
agcggatatgttcgaagcagcaatgtggctgtgaccgtctttgaggaaagctccttcata
gtcctggaccacagtggcatttttgagacagagtttatcagccttttagaagagactcag
tttacaatcctcatcaccgcatatccagcccccaaaatcacatggatgaaagacaacaac
ctcataccagaaagctactacgtcttcacccaaactagtcactttgaaggcaatcggtat
cagagcgttctgacacttcaacaaccattggagaaagacagcggaaattacaccatcaca
gccctcagcggctcccacacggctcacttttctttcatcctcgtagtgaaagcttctagt
ggagcgatgttccccccttcaacggcccctgtgctgttaccagataaggaggagttgttg
gtgcccctccacactcctttcaccatgacatgtcgcggacaggccaaactagagtgggac
acaccctataatgttcccgtgcgtgtacagcaggaccacagcgggctttttgtcaccacc
atcacggtggattgggctgaagcatatcacacaggctcctataagtgcttctacagtgga
agcaacacggaggattccaaaagccagagcatctatgtctttgtgccagatcctgatgtt
cctttcgttccatcattgatgccttttagcaaccatgtcctatccgatcacgaggaaatg
gagattcagtgcagggtgtctgatccaagcgctaacgtgacgttgataaacttggaaacc
caggagcccgtgccgagtgtttacgacagtaagaggggggctttgggggtgttcctagct
ggaacctatgtctgcaaggccctcataaatggacatgagtactacagtgaagaatacatt
gttcatggttggccaggtggaacagcgcttcatgttgaactgaaagctaaaaggaccgcc
ctactggtgggagaaacaatcactgtcacctgcctggctcgaggacccgagatcctggag
gacaactggaaatacccgggcaaagcggctaaccgtggtaccaaaacagtgcgcgagaac
aagaaagatcaggagatcctctacaccctgacaatcccacaggcctcagtcaaagacagt
ggcagctactcctgttctattgttgatatagctaacaatgaaattcagacaaaagaacaa
gaaattcaggtgtttgctggtgaatttgtatcaattgatccggagttcggggagcacgaa
tctgcagagctggatgaagttcgggaattcagggcaaatgtccactcctttcccaatgcc
cgtgtcacttggatcaaagatgggattcttctcagtgatgtgacagcagagatctccacc
agcctgcggcaaaccagcgagaccagttacatgagtgttctcacactgatccgggctaag
ggggaggacagtgggaattacaccatgcgagtggagaacggaaaccagagtcgacatgtc
agcttaatcctagaggtcaaagtgcctgctgtcatcgtggacctgatggacatccatcat
ggctcagccataggccagtctgtggtgtgcataaccagagggcggcccacacctgcggtg
gagtggttcatctgcaagagcatcaaacactgtggcaacaactcatctttttgggtgccc
ctcgctaccaactccacagacatcgtgtttgattcgcacttcgaaggcaataacctggag
agccaggtcgtgtttggtcacctggagagcacgctggcggtccgctgcctagccaggaat
gaaatggccactgtcagcagggaggtcaaactggtgtctagcggcccccaccctgagctg
actgtggctgctgccgtactggtgctcctggtcattgtcatcatctcactcattgtcttg
gttgtcatctggaaacagaagccacgatatgagatccgctggagggtcatagagtctgtt
agtccagacggccacgaatacatctatgtggaccccatgcagcttccctacgactctaga
tgggagtttccccgtgacagacttgtgcttggtcgtgtcctgggctctggagcatttggg
aaggtggttgaaggaactgcctatggactcagtcgctctcaaccagtcatgaaagtggct
gtaaaaatgttaaaacccacagcccgctccagcgagaaacaggccctcatgtcagaactg
aagatcatgactcatctcggaccccacctcaacattgtgaaccttctgggagcatgcacc
aagtcaggccctatttacattatcacggagtactgcttctacggagatctggtcaactac
ctgcacaagaacagggagaacttcctcagcctgagcccagaaaaaaatagaaaagagatg
gatatatttgggatcaatcctgcagatgagagcagtaggagctatgtgatcctgtccttt
gaaagtaaaggggactacatggatatgaagcaggctgacaacactcagtatgtgccaatg
ctggagatgaacaatgcctccaagtactcagacgtccagaggtcaaactacgatcaccct
ccctcgcagaaaggctcaagtgaatgtgagatggaaaacctgctgtcagatgacaccact
gaaggcctaacaaccactgacctgctgagctttacctaccaggtggccaaaggaatggaa
tttctctcttccaaaaattgcgtgcaccgagaccttgcagccaggaacgtactcctctct
cagggcaagatagtgaagatctgtgactttggactggcccgggacatcatgcatgacagc
aattatgtctccaaagggagtacctttcttcctgtgaaatggatggcaccagaaagcatt
tttgacaacctgtacaccaccctcagtgatgtttggtcttacggcatcctcctttgggag
attttttcgttaggtgggaccccttaccctgggatggtggtggactccagcttctacaac
aagatcaagagtggatataggatgtccaaacctgaacacgcaccgcaagatatatatgag
acgatgatgaagtgctggaacagtgatccagagaagaggccctccttcatgggtctaagt
gaaagtgtagcattgctgctgccctccagctataggaggcattatgagagggtaaaccgg
gacttcctgaaaagtgaccatcctgctgtcacccgggtgtgcatggaaaacgacaccgac
tatgttgacattccctacaagaaccaaggcaagctgaaggagcgggagagcggctttgat
gagcagcgcctgagctcagatagtggctacatcattccactccctgacctggaccccctc
tctgatgaagaatatggaaaaaggaacagacatagctctcagacatctgaggagagcgcc
atcgagacagggtcgagcagctccacctatcctaaacgtgaaggagagacgctcgaggac
atcacactgctggacgagacgtgtctggactgtagtgacctggtggaggacagctttctc
taa

DBGET integrated database retrieval system