KEGG   Oryzias latipes (Japanese medaka): 100049321
Entry
100049321         CDS       T02443                                 

Gene name
tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04137  Mitophagy - animal
ola04210  Apoptosis
ola04216  Ferroptosis
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049321 (tp53)
   04310 Wnt signaling pathway
    100049321 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100049321 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    100049321 (tp53)
   04210 Apoptosis
    100049321 (tp53)
   04216 Ferroptosis
    100049321 (tp53)
   04115 p53 signaling pathway
    100049321 (tp53)
   04218 Cellular senescence
    100049321 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100049321 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    100049321 (tp53)
   03036 Chromosome and associated proteins [BR:ola03036]
    100049321 (tp53)
   03400 DNA repair and recombination proteins [BR:ola03400]
    100049321 (tp53)
Transcription factors [BR:ola03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100049321 (tp53)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100049321 (tp53)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100049321 (tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 100049321
NCBI-ProteinID: NP_001098212
UniProt: P79820
LinkDB
Position
18
AA seq 352 aa
MDPVPDLPESQGSFQELWETVSYPPLETLSLPTVNEPTGSWVATGDMFLLDQDLSGTFDD
KIFDIPIEPVPTNEVNPPPTTVPVTTDYPGSYELELRFQKSGTAKSVTSTYSETLNKLYC
QLAKTSPIEVRVSKEPPKGAILRATAVYKKTEHVADVVRRCPHHQNEDSVEHRSHLIRVE
GSQLAQYFEDPYTKRQSVTVPYEPPQPGSEMTTILLSYMCNSSCMGGMNRRPILTILTLE
TEGLVLGRRCFEVRICACPGRDRKTEEESRQKTQPKKRKVTPNTSSSKRKKSHSSGEEED
NREVFHFEVYGRERYEFLKKINDGLELLEKESKSKNKDSGMVPSSGKKLKSN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggatcctgtacccgacctgcccgagagccaaggttcttttcaagaactctgggagact
gttagttatcctccgttggaaactttatcacttccaactgtaaatgagcccaccgggtca
tgggtcgcaacgggggatatgtttctcttggatcaagacctcagtgggaccttcgatgac
aagatcttygacataccgattgagccagttcccaccaacgaagtaaacccgccaccyacc
accgtcccggtgaccaccgactacccgggaagctacgaactggaacttcgttttcaaaaa
tctggcactgcaaagtctgtgacgtccacatactctgaaactttaaataagctgtactgc
cagcttgcaaaaaccagccccatagaagtccgggtgagcaaggagcctccaaagggcgcc
attctcagggccactgcggtctacaagaagacggagcacgtggcggacgtggtgaggagg
tgtccccaccaccaaaacgaggactctgtggagcaccgaagccatctgattcgggtggag
ggcagccagctggcccagtattttgaagacccttataccaaaaggcagagtgttacagtt
ccttatgagcccccgcagccgggctctgagatgaccaccatcytgctyagctacatgtgt
aacagctcgtgcatgggggggatgaaccgcagacccatcctcaccatcctcactctggaa
accgagggtctggttcttggccggaggtgtttygaggtcagaatctgtgcttgcccgggg
cgggaccgcaaaacggaggaggaaagccggcagaaaacgcagcccaaaaaaaggaaggtg
acacccaacacctcctcctctaagaggaagaagtcccactcaagtggagaggaggaggac
aacagagaagtctttcattttgaggtttatgggagggagcgctacgagttccttaagaag
ataaacgatggccttgaactgctggaaaaggagagcaaaagtaaaaacaaagattctggg
atggtcccctccagtgggaagaagctgaagagcaattaa

DBGET integrated database retrieval system