KEGG   Oryzias latipes (Japanese medaka): 100049322
Entry
100049322         CDS       T02443                                 

Gene name
kras
Definition
(RefSeq) GTPase KRas
  KO
K07827  GTPase KRas
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04540  Gap junction
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049322 (kras)
   04012 ErbB signaling pathway
    100049322 (kras)
   04370 VEGF signaling pathway
    100049322 (kras)
   04371 Apelin signaling pathway
    100049322 (kras)
   04068 FoxO signaling pathway
    100049322 (kras)
   04150 mTOR signaling pathway
    100049322 (kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100049322 (kras)
   04137 Mitophagy - animal
    100049322 (kras)
  09143 Cell growth and death
   04210 Apoptosis
    100049322 (kras)
   04218 Cellular senescence
    100049322 (kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100049322 (kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100049322 (kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100049322 (kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100049322 (kras)
   04912 GnRH signaling pathway
    100049322 (kras)
   04914 Progesterone-mediated oocyte maturation
    100049322 (kras)
   04916 Melanogenesis
    100049322 (kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    100049322 (kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ola04031]
    100049322 (kras)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100049322 (kras)
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100049322 (kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha Gtr1_RagA ATP_bind_1 Septin AAA_25
Other DBs
NCBI-GeneID: 100049322
NCBI-ProteinID: NP_001098213
UniProt: A0A3P9LH79 O57467
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PTRTVDTKQAQDLARSFGIPFIETSAKTRQRVEDAFYTLVREIRQYRLSKLSKEEKTPRC
VNLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatataagctggttgtggttggagctggtggtgttggcaagagcgcgcttacc
attcagctcatccaaaaccattttgtggatgaatatgaccccaccattgaggactcctac
agaaaacaggtagtaattgatggagagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggggaaggcttcctctgt
gtttttgctatcaacaacaccaagtcttttgaagacattcaccactatagagaacagatt
aagcgggtgaaggactctgaggacgtccccatggtgttggtgggaaacaagtgtgacctc
ccgacccggacggtggacaccaagcaggctcaggacttggcacgcagctttggcattccc
tttattgaaacctctgccaaaaccagacagagagtggaagatgccttttacactctggta
cgggagatcaggcagtaccggctcagtaagctcagcaaggaagaaaagactccacgctgt
gtcaaccttaaaaagtgtgttgtgatgtga

KEGG   Oryzias latipes (Japanese medaka): 101154954
Entry
101154954         CDS       T02443                                 

Definition
(RefSeq) GTPase HRas
  KO
K07827  GTPase KRas
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04540  Gap junction
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101154954
   04012 ErbB signaling pathway
    101154954
   04370 VEGF signaling pathway
    101154954
   04371 Apelin signaling pathway
    101154954
   04068 FoxO signaling pathway
    101154954
   04150 mTOR signaling pathway
    101154954
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101154954
   04137 Mitophagy - animal
    101154954
  09143 Cell growth and death
   04210 Apoptosis
    101154954
   04218 Cellular senescence
    101154954
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101154954
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101154954
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101154954
  09152 Endocrine system
   04910 Insulin signaling pathway
    101154954
   04912 GnRH signaling pathway
    101154954
   04914 Progesterone-mediated oocyte maturation
    101154954
   04916 Melanogenesis
    101154954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101154954
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ola04031]
    101154954
Membrane trafficking [BR:ola04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101154954
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101154954
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N ATP_bind_1 VirE Septin AAA_14 SatRNA_48 AAA_25
Other DBs
NCBI-GeneID: 101154954
NCBI-ProteinID: XP_004071559
UniProt: A0A3B3H9X1 A0A3P9H5A6
LinkDB
Position
8
AA seq 186 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHVYREQINRVKDSDNVPMVLVGNKSDL
STRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRKYKETYRNKKSKKGSQ
RRCTIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggggctggaggtgtggggaaaagcgccctgacc
atccagctcatccagaaccactttgtggacgaatatgacccaaccattgaggactcctac
agaaagcaggtggtgatcgacggagagacgtgtctgctggacatcctggacactgcaggt
caagaggagtacagcgccatgagggaccagtacatgaggacgggagagggcttcctctgt
gtgtttgccatcaacaacgcaaagtcttttgaggacgttcatgtgtacagagagcagatc
aaccgagtgaaggacagtgacaacgttcccatggtgctggtggggaacaagagtgacctg
agcacccgcactgtggagacccggcaagcgcaggagttggcccggagctacggagtcccc
ttcgtggagacctccgccaaaaccagacagggggttgaggaggccttctactcgctggtg
cgggagatcagaaaatacaaagagacctaccgcaacaagaaaagcaaaaagggttctcag
agacggtgcacgattctatag

KEGG   Oryzias latipes (Japanese medaka): 101159234
Entry
101159234         CDS       T02443                                 

Gene name
mras
Definition
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04218  Cellular senescence
ola04371  Apelin signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101159234 (mras)
   04371 Apelin signaling pathway
    101159234 (mras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101159234 (mras)
   04137 Mitophagy - animal
    101159234 (mras)
  09143 Cell growth and death
   04218 Cellular senescence
    101159234 (mras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101159234 (mras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101159234 (mras)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ola04031]
    101159234 (mras)
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101159234 (mras)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase ATP_bind_1 MMR_HSR1 Septin Gtr1_RagA AAA_16
Other DBs
NCBI-GeneID: 101159234
NCBI-ProteinID: XP_004082041
UniProt: H2MV62
LinkDB
Position
21
AA seq 209 aa
MAMSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAFP
MVLVANKVDLVHLRKVTAEQGHEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQVP
ERNQKKKKKKMKWRAERSTGSHRFHCSIL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgatgagcgcagtgccaagtgacaacttgccaacctacaagctggttgtggtgggg
gatggaggtgtcggtaaaagtgctttaaccatccagtttttccagaagatctttgtgcca
gactatgatcccaccatcgaggactcttaccttaaacacacagagatcgatggacagtgg
gccatacttgatgtgctggacacggcaggccaggaggagttcagcgccatgagggagcag
tacatgaggacgggggacggcttcctcatcgtcttttccgtcacggacaaggccagcttt
gagcacgtggaccggttccatcagctcatcctgcgggtcaaagacagagaggccttcccc
atggtgctggtggctaacaaggtggacttggtgcatttacgaaaggtcaccgcagagcag
ggccacgagatggctgcaaaacacaacataacctacattgaaaccagtgccaaggatcct
ccgatgaacgtggacaaagccttccatgaactggtccgagttataaggcaacaggttcca
gagcgaaaccagaagaagaagaagaagaagatgaagtggagggcagagcggtccacgggt
tcccacaggttccactgctccatcttgtga

KEGG   Oryzias latipes (Japanese medaka): 101162668
Entry
101162668         CDS       T02443                                 

Gene name
rras2
Definition
(RefSeq) ras-related protein R-Ras2
  KO
K07830  Ras-related protein R-Ras2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04218  Cellular senescence
ola04371  Apelin signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101162668 (rras2)
   04371 Apelin signaling pathway
    101162668 (rras2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101162668 (rras2)
   04137 Mitophagy - animal
    101162668 (rras2)
  09143 Cell growth and death
   04218 Cellular senescence
    101162668 (rras2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101162668 (rras2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101162668 (rras2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101162668 (rras2)
   04031 GTP-binding proteins [BR:ola04031]
    101162668 (rras2)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101162668 (rras2)
  Exosomal proteins of bladder cancer cells
   101162668 (rras2)
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101162668 (rras2)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1
Other DBs
NCBI-GeneID: 101162668
NCBI-ProteinID: XP_023809215
LinkDB
Position
3
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLEIQRQVNQEEGQNLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQD
CPPSPEPTRKEKNKRGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcaggctggaaggacggctcggtgcaggagaagtatcggctggttgtggtcggaggc
ggaggtgtcgggaaatcggccttgactatccagtttattcagtcttactttgtcaccgat
tatgacccaacaattgaagactcttatactaagcagtgcgtgatcgacgaacgggcggcg
cggctcgacatcctcgacacggctggacaggaagagtttggagccatgcgagaacaatac
atgaggacaggggagggcttcctgctcgtcttctcagtgaccgacagaggaagctttgaa
gagatctacaaatttcaaagacaaatcctccgagtcaaagacagagacgagttccccatg
atccttgtaggaaacaaagccgatttggagatacaaagacaagtcaaccaggaagagggt
cagaatttggcgagacagttaaaagtcacgtatatggaggcttcagccaaaatccgaatg
aacgtagaccaggctttccatgaactggttagagtaatcaggaaattccaagaacaggat
tgtccaccctcgccagaaccaacgagaaaagagaaaaacaagcggggctgccattgtgtg
attgtctga

KEGG   Oryzias latipes (Japanese medaka): 101165278
Entry
101165278         CDS       T02443                                 

Gene name
hras
Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04144  Endocytosis
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04540  Gap junction
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04916  Melanogenesis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101165278 (hras)
   04012 ErbB signaling pathway
    101165278 (hras)
   04370 VEGF signaling pathway
    101165278 (hras)
   04371 Apelin signaling pathway
    101165278 (hras)
   04068 FoxO signaling pathway
    101165278 (hras)
   04150 mTOR signaling pathway
    101165278 (hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101165278 (hras)
   04140 Autophagy - animal
    101165278 (hras)
   04137 Mitophagy - animal
    101165278 (hras)
  09143 Cell growth and death
   04210 Apoptosis
    101165278 (hras)
   04218 Cellular senescence
    101165278 (hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101165278 (hras)
   04540 Gap junction
    101165278 (hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101165278 (hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101165278 (hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101165278 (hras)
   04912 GnRH signaling pathway
    101165278 (hras)
   04916 Melanogenesis
    101165278 (hras)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101165278 (hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101165278 (hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101165278 (hras)
   04031 GTP-binding proteins [BR:ola04031]
    101165278 (hras)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101165278 (hras)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101165278 (hras)
  Exosomal proteins of colorectal cancer cells
   101165278 (hras)
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101165278 (hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin
Other DBs
NCBI-GeneID: 101165278
NCBI-ProteinID: XP_023811965
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PVRTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDSGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagctggtggtggttggagccggaggtgtggggaagagcgcgctcacc
atccagctcatccagaaccactttgttgacgaatacgaccccactatagaggactcctac
cggaagcaggtggtgatcgacggcgagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgcgggaccagtacatgcggacgggggagggcttcctctgc
gtctttgccatcaacaacaccaagtcttttgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactctgacgacgtccccatggtgctggtggggaacaagtgtgacctt
ccggtgcgcacggtagaaacccggcaagcccaggaattggcccggtcctacggtatccct
tacatcgagacctctgctaaaacccggcagggggtggaagatgctttctacactctggtc
agggagatccggcaacataagctacggaagctgaacccccccgatgacagcggtcaggac
tgcatgagctgtcgctgcgtggtctcctga

KEGG   Oryzias latipes (Japanese medaka): 101174431
Entry
101174431         CDS       T02443                                 

Definition
(RefSeq) ras-related protein R-Ras
  KO
K07830  Ras-related protein R-Ras2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04218  Cellular senescence
ola04371  Apelin signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101174431
   04371 Apelin signaling pathway
    101174431
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101174431
   04137 Mitophagy - animal
    101174431
  09143 Cell growth and death
   04218 Cellular senescence
    101174431
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101174431
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101174431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101174431
   04031 GTP-binding proteins [BR:ola04031]
    101174431
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101174431
  Exosomal proteins of bladder cancer cells
   101174431
GTP-binding proteins [BR:ola04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101174431
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 101174431
NCBI-ProteinID: XP_023813635
LinkDB
Position
8
AA seq 196 aa
MSEEDRYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKVCTVDGKETRLDILD
TAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMLLVGNK
ADLEQQRVISSEDAQAFARENRIHYMEASAKNRYNVDEVFLKLVHIIRRFHEMESPPPQA
QHAGKQKSGGCPCVLL
NT seq 591 nt   +upstreamnt  +downstreamnt
atgagcgaagaggacaggtacaagctggtcgtggtggggggaggaggagtggggaagagc
gcgctgaccatccagttcatccagtcgtactttgtgtcagactatgacccaaccattgag
gactcctacaccaaggtctgcaccgtggacgggaaggagacccggctggacatcttggac
acagcaggtcaggaggagttcggagcgatgagggagcagtacatgcgctcaggagagggc
ttcttactggtgttcgctctgaacgaccggggcagttatcatgaggtccagaagtttcac
acccagatcctgagagtgaaggaccgagacgacttccccatgctcctggtgggaaacaag
gccgacctggagcagcaacgagtgatctccagtgaggacgcccaggcctttgccagagag
aacaggatccactatatggaggcttcagccaagaaccgctacaacgtggacgaagtcttc
ctgaagctggtgcacatcatcaggaggtttcatgagatggaaagtcctcctccccaagct
cagcacgcgggcaaacagaagagcggtggctgtccctgtgtcctcctctga

DBGET integrated database retrieval system