KEGG   Oryzias latipes (Japanese medaka): 100049400
Entry
100049400         CDS       T02443                                 

Gene name
casp8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100049400 (casp8)
   04217 Necroptosis
    100049400 (casp8)
   04115 p53 signaling pathway
    100049400 (casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100049400 (casp8)
   04621 NOD-like receptor signaling pathway
    100049400 (casp8)
   04622 RIG-I-like receptor signaling pathway
    100049400 (casp8)
   04625 C-type lectin receptor signaling pathway
    100049400 (casp8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100049400 (casp8)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100049400 (casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    100049400 (casp8)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100049400 (casp8)
Peptidases and inhibitors [BR:ola01002]
 Cysteine peptidases
  Family C14: caspase family
   100049400 (casp8)
SSDB
Motif
Pfam: DED Peptidase_C14 Toxin_trans
Other DBs
NCBI-GeneID: 100049400
NCBI-ProteinID: NP_001098258
UniProt: Q56VC9
LinkDB
Position
17
AA seq 481 aa
MDRRTLSRIDDELNSEEVAELCFLCTDFIPRKRLEGISSAKDLFLKLEDATLLDSSYLTQ
LFRTIHREDLVRQVQNGSRQAEEADAVPSLSDYRVMLYSIHDDMTEENLDKLKFLLNPKL
NRRPLEKSKTALDVFVEMEKSQLISKDDVSGLYKLLLEFDKKLAAVVEKYMQDHRGALTD
TSHYQKRPSIPSLESLSVSQPETWSETEDPNNGVRSDATPCPDPPTSPDEEEYYSFTHEP
RGLCVIFNNKLFFPESNLGERGGTEKDEKSLNNLFHRFGFEVVVHNNLTADLIESEITKL
GQRNFSHDDALVVCVLSHGDNGCVYGIDGKKVQLRALTLPFPSYRAPSLIGKPKLFFIQA
CQGTLAQSGYLPGSEVKGDAELEADASSSTSNSVPNDADFLLGMATVAECKSFRNKYTGS
IYIQELCRQLERAAESSKMEDILGVLVHVNREVSKGVFLNKKQMPEPKYTLTKKVVLKYM
N
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggacaggcggacactgtcccgtatagatgatgagctgaactctgaggaggtggcggag
ctttgcttcttgtgcaccgattttatccccagaaaacgtttggaggggatcagttcagct
aaagatcttttcttaaaacttgaggacgcaactttgctggacagctcttacctcactcag
ctgttcagaactatccatcgagaagacctcgtcaggcaggtgcagaatggaagcagacaa
gcagaggaagccgatgccgttcccagtttgtctgattacagagtgatgctgtacagcata
catgatgacatgaccgaggagaaccttgacaaactgaaatttctgttaaaccccaagttg
aacagaaggccactggagaagagcaaaactgctctggatgtatttgttgaaatggagaag
tcacaattaatatcaaaagacgacgtctctgggctttataaactgctcttggagtttgat
aaaaagctggcagcagttgtcgagaagtacatgcaagatcatcgtggagcattaactgat
accagccactatcaaaagagacccagcatcccttcgcttgaatcgctttctgtgtctcaa
cctgagacttggtccgagactgaggatccaaacaatggagtaaggtctgatgcaacacca
tgtccagacccaccaacttcacctgatgaggaggagtattacagttttactcatgaacct
cgaggtttgtgcgtgatttttaacaataagttattcttccccgagtcaaacctcggtgaa
cgaggtggaactgagaaagatgaaaagtctctcaacaacttgttccatcgttttggcttt
gaggttgtggtgcacaacaatctcactgcagatttaattgaatctgaaataacaaaactg
ggacagagaaatttctcgcatgatgatgctttggtagtctgtgtcctttcccacggcgac
aacggatgtgtttatggaattgatgggaagaaagttcaactgcgagctctgaccctaccc
tttcccagttaccgagcccctagcttgataggaaagccaaaacttttctttatccaagca
tgtcaaggcacactagcccaaagtggttatcttccaggttcggaagtgaaaggggatgca
gagttggaagctgatgcatcatctagcaccagcaactctgtgcccaatgatgctgacttc
ttgctgggcatggcaacagtggcagagtgcaaatcttttagaaacaagtacacaggctcc
atctacatccaggagctgtgcagacagctggaaagagctgcagagagctcaaagatggag
gatattctgggtgtcctggtccacgtgaacagagaagtcagcaaaggagtgtttttgaac
aaaaagcagatgcctgagcccaaatatacgctcaccaagaaggttgttcttaaatatatg
aactga

KEGG   Oryzias latipes (Japanese medaka): 100125536
Entry
100125536         CDS       T02443                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100125536
   04217 Necroptosis
    100125536
   04115 p53 signaling pathway
    100125536
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100125536
   04621 NOD-like receptor signaling pathway
    100125536
   04622 RIG-I-like receptor signaling pathway
    100125536
   04625 C-type lectin receptor signaling pathway
    100125536
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100125536
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100125536
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    100125536
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100125536
Peptidases and inhibitors [BR:ola01002]
 Cysteine peptidases
  Family C14: caspase family
   100125536
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100125536
NCBI-ProteinID: XP_023820994
LinkDB
Position
17
AA seq 389 aa
MSAKDTLRSNKTAILSTLCADQRLILNKVHENRLITTREYNNLKSINKEDVEGHVVELLD
KILNKGETVCQDFLKILQTDEEIKSTFPELKQQLQLEEISFPKSIQVSSSNDEYMLHDNK
RQKREEVYQLNTRPVGICVIINNQNFLDGSVRRGTEKDAESLAEVFSWLGFRVLMCKDQT
SDQMKGTLECLSLLSSSTDLLKLQAQEWSESRYAGPQQALQHGDAFVCCILSHGQKGMVL
GIDQMPVPIKHITRIFKASEQSALTGKPKMFLIQACQGGQIHKGVALTDVEADDCSTQTI
PEEADILVALATVEDYPAYRHISEGSWFVQSLCQQLKERCPKGEDITAILHHVNDDVGLK
EGSSRMPGAIKQMPEVRFTLRKKVVLTPN
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtcggctaaagacactttaaggagtaataaaacagctattctgtcgactttgtgcgcg
gatcagaggctcatcctcaacaaagtccatgagaatcgcctcattacgactcgggagtac
aacaacctcaaaagcatcaacaaagaagacgtggaaggacacgttgttgagcttctggat
aagattttgaataaaggcgaaacagtctgtcaagatttcctcaaaatcttgcaaacagat
gaggaaattaaatctacttttccagaactgaagcaacaactgcagctagaagaaatctct
tttcctaagtcaatccaagtgtcctcttcaaacgatgaatacatgctgcacgacaacaag
aggcagaaaagggaggaggtttatcagctgaacactcgtcctgtcggcatctgcgtgatc
ataaataaccagaatttcttggacggctcagtgagaagaggcacagagaaagatgctgaa
agcctggcggaggtgttttcatggttggggttcagagtgctgatgtgcaaagatcaaacc
agtgatcagatgaaggggaccctggaatgcttatcattactgtccagctccactgacctg
ctgaagcttcaggctcaggagtggtctgagagcagatacgccggtcctcaacaagcgctt
cagcacggcgatgcatttgtttgctgcattctgagtcatggacaaaagggaatggttttg
gggattgaccagatgcccgttcctattaaacatataacccgaatcttcaaggcatctgag
cagtcagctctcacagggaagcccaaaatgttcctgatacaagcctgccagggagggcag
atccacaaaggggtggcactgacagatgttgaggcggatgattgcagtacacaaaccatc
ccagaggaagcagatatcttggttgccttggccactgtggaagattacccagcttacaga
cacatttctgaaggcagctggttcgtccagtctctgtgtcagcagctaaaggagcgctgc
cccaaaggagaggacatcactgccatcctccaccatgtgaatgatgatgtgggactgaag
gagggctcctcccgcatgcccggtgccataaagcagatgcctgaagtgaggttcacactg
aggaagaaagtcgtgctgacgccaaattaa

DBGET integrated database retrieval system