KEGG   Oryzias latipes (Japanese medaka): 100049464Help
Entry
100049464         CDS       T02443                                 

Gene name
etgase
Definition
(RefSeq) embryonic transglutaminase
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100049464 (etgase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 100049464
NCBI-ProteinID: NP_001098300
UniProt: Q764P8
LinkDB All DBs
Position
18
AA seq 738 aa AA seqDB search
MSDTSATPTSPPAPTPTPSKGNRRGRKAGPADNSNSEFANFPEVEYFIAPGPRGYPPLTE
FLDIWDVDMIRRIDESNKLEHHTELYNSENLIVRRGQEFQIKLTFNRPYKPDEDKFAVEF
TIGSSPQFSKGTYIPVFFTKERQSSWAGRAIANSDNIVTVGITPATNCIVGKYNLYVAVV
TPYGVRRQRPDKSREMYILFNPWAKDDAVFLDDEMERQECVMNEMGIIYHGAYNDVAERS
WNYGQFNYGVLDACLFILDHSEMPIINRGDPVKVTRQASAMMNSQDDNGVLVGDWSGDYI
YGVSPTSWTGSTDILISYARSKAPVRYAQCWVYAGVFNTFLRCLGIPSRVVTNFFSAHDN
DGNLKTDIILDENGKIDKNRTRDSVWNYHCWNECYMSRPDLPQGYGGWQIVDATPQETSD
GMYRCGPASVHAIKHGEICFPYDAAFVFAEVNSDVVFYSRRRDGTLDLVKVNRTHIGRMV
LTKAPGEETRRDITSQYKFPEGSAEERTVLEKAEEYGCKRVKDNPSLADVDLTLPTLEIS
VGDDFELDLEFVNHTKEKRTVAAYISGSVVYYTGVPAMSPVQTPHCSNWPQKSVKELVQI
ESKKYMQHLVEQCNLNFIVTGKIKETGKIVTATKLVTLHNPKLTVEVSGNAKVNEEMMVT
VEFTNPFSFSLEDVNVRMEGPGVMLPRRKTFSLILGGSHLTWTELFSPQRPGKTRIIATL
DCPSLRQVDGQVSLTVEP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataccagtgccaccccaacctctccccctgcccccacgccaactccctctaag
gggaacaggcgcggccggaaagcaggccctgctgacaactctaactcagagtttgccaac
tttcctgaagtagagtattttattgcacctggaccaagaggatacccacccctgacagag
tttctggacatctgggatgtggatatgataagaagaattgatgagagcaacaagttagag
caccacaccgagctctacaactcggaaaatctcattgtgcgcagaggacaggagtttcaa
atcaagctgaccttcaatcgcccctacaaaccagatgaagacaagtttgcagtggagttt
accattggctcgagcccgcagttcagcaagggcacctacatccctgtcttcttcacaaag
gagcgtcagagttcatgggcaggtcgcgccattgcaaactcagacaacatcgtcactgta
ggcatcactcctgcaacaaactgcattgtggggaagtacaacttatacgtcgctgtggtc
acgccttatggcgtccgcaggcaacgaccagacaaaagccgagagatgtacatcctcttt
aacccctgggctaaagatgatgctgtgttcctggatgatgagatggagaggcaggagtgt
gtgatgaatgagatggggattatctatcatggtgcttacaacgacgttgctgaaagaagc
tggaactatggacaattcaactatggagtcctagatgcttgtctcttcatcttggatcat
tcagaaatgcccatcatcaacagaggagatcccgttaaagtaaccagacaagcttccgcc
atgatgaattctcaagatgacaatggtgtgttggttggggattggagcggtgactacatc
tatggagtgtcacccacttcctggaccggcagtacggacatcctgatcagctatgccaga
agcaaagcacccgtccgctatgctcagtgctgggtctacgccggcgtcttcaacacattc
ctgcgctgtcttggcatcccgtctcgtgttgtgaccaacttcttctctgcacacgacaat
gatggaaatctgaagactgacatcatcttagacgagaatggcaaaattgacaaaaaccgc
accagggactctgtatggaattaccattgctggaatgagtgctacatgtctaggcctgac
ctcccccagggctatggcggctggcagattgtggatgcaactccacaggagaccagcgat
ggtatgtacagatgtggaccagcatcagtccatgcaatcaaacacggagagatatgcttt
ccctatgatgcagcctttgtgtttgctgaggttaacagcgatgtggtattttattcccga
aggagagatgggactttggatcttgtcaaagttaatcgcactcacataggtcgcatggtt
ttgacaaaagctccaggcgaggagactcgccgtgacatcaccagtcaatacaagtttcct
gagggcagcgcagaggagaggactgtcctggaaaaggcagaagagtacggctgcaaacgc
gtaaaggacaacccatctctggctgacgtggacctgactctcccaactctggagatcagt
gtcggcgatgactttgagttagatctggagtttgtaaaccatactaaggagaagcgaaca
gtggcggcttacatcagtgggagcgtagtttactatactggtgttccggccatgagtcct
gttcagaccccccactgttcaaattggccacaaaaaagtgtcaaagaactggtgcagatt
gagtcaaaaaagtacatgcagcacctggtggaacagtgcaacctcaactttattgtaaca
gggaagatcaaagagacgggaaagattgtcactgcaaccaaacttgttactctacacaac
cccaaactcaccgtggaggtgtctggaaacgccaaagtgaatgaagagatgatggtgact
gtggagttcaccaaccccttcagcttcagccttgaagacgtgaacgttcgcatggaagga
ccgggggtcatgttgccgaggcgcaaaactttcagtttgatccttggaggctcccatctt
acctggactgagctgtttagcccccaaaggcccggcaaaaccaggataattgccactctg
gactgtccttctctgcggcaggttgacggccaggtgtccctaactgtcgaaccctga

DBGET integrated database retrieval system