KEGG   Oryzias latipes (Japanese medaka): 100049477
Entry
100049477         CDS       T02443                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04217  Necroptosis
ola04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100049477 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100049477 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100049477 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    100049477 (stat3)
Transcription factors [BR:ola03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100049477 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 100049477
NCBI-ProteinID: NP_001098308
UniProt: Q6GUE7
LinkDB
Position
8
AA seq 785 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
STSQDGSAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELNQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMGESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPSVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAHEPEAGGDSASITQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMMSPRTLDSLMHNEPEAHSGHLDSITLDMD
VASPM
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggctcagtggaatcagttgcagcagctggagaccaggtatctggagcagctctaccac
ttgtacagcgacagctttccaatggagctacgccagtttcttgcaccctggattgaaagt
caagactgggcctatgctgccaacaaagaatcccacgccaccctggtgttccacaatctc
ctgggagaaattgatcagcagtatagccgtttcctccaggagaacaatgtcctctaccaa
cacaacctgcgcaggataaagcagcatctgcagagcaagtatctggagaagccaatggaa
atcgcccgcattgtcgcccgctgtttatgggaggaacagcgactgctgcagacagccacc
tctacttcccaggatggttcagcagcccatcccaccggaacagtcgtgacggagaagcag
caaattctggagcacaaccttcaagatatcaggaagcgcgttcaggacatggaacagaag
atgaagatgcttgaaaacctgcaagacgactttgattttaattacaaaaccctgaaaagc
caaggagagctgaaccaggacttgaatggaaacagccaggcagctgccactcgacagaag
atggctcaacttgagcagatgttgagcgctttagatcagctcaggcggcaaattgtgaca
gaaatgggaggcctgctgactgccatggactacgtacagaagaatctaacggatgaagaa
ctggcagattggaagagaagacagcaaatcgcctgcatcggagggccaccaaacatctgc
cttgatcgccttgaaacatggatcacatccttggctgaatcccagctccagattcgtcag
cagatcaagaagctggaggagcttcagcagaaggtgtcctacaaaggagatccaatcatt
cagcaccggcccgccctagaagagaagatagtggatctgttcagaaacctcatgaaaagc
gcctttgtggttgagagacagccgtgtatgcccatgcatccagacagacctttggtcata
aaaacaggagtgcagttcacaaacaaagtcaggttgctggtaaagtttcctgaactcaac
taccaactgaaaattaaagtctgcattgacaaggagtctggagatgtggctgccattcga
gggtcacggaagtttaacatcctcggtaccaacacaaaagtcatgaacatgggggaatct
aacaatggcagcctgtctgcagagtttaagcatttgacccttcgagaacagaggtgtggg
aacggaggaaggaccaacagcgatgcctcattgattgttactgaagagctccatctgatc
acttttgagacagaagtctatcaccagggattaaagatcgatctggaaactcattccctg
cctgttgtggtcatctcaaacatctgccaaatgcccaacgcctgggcttccatcctgtgg
tacaacatgctcacgaatcaccccaagaacgtcaactttttcaccaagcctcctgtgggg
acttgggaccaagtggctgaggtgttgagctggcagttctcctccaccacaaagagaggc
ctgaccattgagcaactcaccacactggctgagaagttactcgggccttctgtcaactat
tctgggtgccagatcacatgggccaagttctgtaaggaaaacatggctggcaaaggcttt
tccttctgggtgtggctggacaacattattgacctggtgaagaagtacatccttgcgctg
tggaacgaaggatacatcatgggctttatcagtaaggagagggagagagccattctgagc
cccaaacctcccggcacctttctgctgcgcttcagcgagagcagcaaagagggtggcatt
acatttacatgggtagagaaagacataagtggaaagacccaaatccagtctgtggaaccg
tacaccaagcagcaactcaacagcatgtccttcgccgacatcatcatgggttacaagatt
atggatgccaccaatatcctggtgtcgcctcttgtttacctctaccctgacatccccaaa
gaggaagctttcgggaagtactgcagaccggaagcagcccatgaacccgaggcaggagga
gattcagcaagcatcacccagccatacttgaagacaaagttcatctgtgtgaccccgtgt
ccctccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcaca
aactctggaaacaccagcgacctgtttccgatgatgtcacctcgcactcttgattccctg
atgcacaatgagcccgaagctcactctggacatttggattccatcactttggacatggac
gtcgcttcccccatgtga

DBGET integrated database retrieval system