KEGG   Oryzias latipes (Japanese medaka): 100049478
Entry
100049478         CDS       T02443                                 

Gene name
cdk1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04540  Gap junction
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100049478 (cdk1)
   04114 Oocyte meiosis
    100049478 (cdk1)
   04115 p53 signaling pathway
    100049478 (cdk1)
   04218 Cellular senescence
    100049478 (cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100049478 (cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100049478 (cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    100049478 (cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    100049478 (cdk1)
   03036 Chromosome and associated proteins [BR:ola03036]
    100049478 (cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    100049478 (cdk1)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100049478 (cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100049478 (cdk1)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100049478 (cdk1)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100049478 (cdk1)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100049478 (cdk1)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100049478 (cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100049478
NCBI-ProteinID: NP_001098309
UniProt: Q9DGD3
LinkDB
Position
15
AA seq 303 aa
MEDYVKIEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAVREVSLLQELKH
PNVVRLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCH
RRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGSPR
YSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDVWPDVESLPDYKNT
FPKWKEGSLSSMVKNLDKNGLDLLAKMLIYNPPKRISAREAMTHPYFDDLDKSTLPAACI
NGV
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaggactacgtgaaaatagagaaaatcggagaagggacatacggggtggtgtacaaa
ggccggcacaagtccacgggacaggtggtggccatgaagaagatccgcctggagagtgag
gaggagggagttcccagcaccgctgtcagggaggtgtcgctgcttcaggagctgaagcac
cccaacgtcgtccggctcttggatgtcctgatgcaggaatctcgcctctacctgatcttt
gagttcctgtccatggacctgaagaagtacctggatagcatcccgtcaggacagtacatg
gaccccatgctggtcaagagctacctctatcagatccttgagggcatttacttctgtcac
cgaaggcgggtcctccaccgcgacctgaagccccagaaccttctgattgataacaagggc
gtcatcaaactggcagactttggcttggcccgggccttcggtgttcccgtccgggtctac
acccacgaggttgtgactctgtggtatcgagctcctgaggtccttctgggttccccccga
tattcaaccccagtggacgtgtggagcacgggtaccatctttgctgaactcgccaccaag
aagcccctgttccacggagactccgagatcgaccagctcttcaggatctttaggactctg
gggacccccaacaatgacgtttggccggatgtggagagcctgcctgactacaaaaacact
ttccccaaatggaaggagggcagcctgtcctccatggtgaagaacctggacaagaacggc
ctggacctgctggcgaaaatgttgatctacaatcctcccaagaggatctctgcacgtgag
gccatgacccacccatactttgatgacctggacaagtccacgctgcccgccgcctgcatc
aacggcgtctga

DBGET integrated database retrieval system