KEGG   Oryzias latipes (Japanese medaka): 100049506
Entry
100049506         CDS       T02443                                 

Gene name
gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049506 (gadd45a)
   04068 FoxO signaling pathway
    100049506 (gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100049506 (gadd45a)
   04210 Apoptosis
    100049506 (gadd45a)
   04115 p53 signaling pathway
    100049506 (gadd45a)
   04218 Cellular senescence
    100049506 (gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    100049506 (gadd45a)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100049506 (gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100049506 (gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100049506
NCBI-ProteinID: NP_001098329
UniProt: Q3LG54
LinkDB
Position
17
AA seq 158 aa
MTFEELNGDYSQERMDSVAKALEEVLTSALPQGAITVGVYEAAKSLNVDPDNVVLCVLAT
DEDDVKDVALQIHFTLIQAFCCENDINILRVNSTRRLEQILAGGGKQSGGEPLDLHCVLV
SSPHSTSWKDPALSKVSRFCRESRGMDQWVPIIYLPER
NT seq 477 nt   +upstreamnt  +downstreamnt
atgacgtttgaggaactgaacggggactattctcaggaaaggatggattcggtagcgaaa
gctctggaggaagttctgacctccgcgctgcctcagggcgccatcactgtcggtgtgtac
gaggctgccaaatctctcaacgtagacccggataacgtggttctgtgcgtcctggccacg
gacgaggacgacgtgaaggacgtggctctgcagatccacttcacactcatccaggctttc
tgctgcgagaatgacatcaacatcctgagggtcaacagcacccggcgcctggagcagatt
ctggctggaggggggaagcagagtgggggggagcctctggacctccactgcgttcttgtc
agtagcccacactcaacatcgtggaaagaccccgccctgagcaaagtcagccgcttctgc
agggagagccggggcatggaccagtgggtgccaatcatctatctgcccgagcggtga

KEGG   Oryzias latipes (Japanese medaka): 101155619
Entry
101155619         CDS       T02443                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101155619
   04068 FoxO signaling pathway
    101155619
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101155619
   04210 Apoptosis
    101155619
   04115 p53 signaling pathway
    101155619
   04218 Cellular senescence
    101155619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101155619
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101155619
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101155619
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101155619
NCBI-ProteinID: XP_004075184
UniProt: A0A3B3ING7
LinkDB
Position
12
AA seq 140 aa
MQFPGRALKEALLCAQSEGRLTAGVYESAKIMTEDPDSVSFCVLAMDEQFQCDIALQIHF
TLIQSFCFDNDISIVRVSDMQRLADIVGDKSEELEDAHCVLITNPADGSWEEPALEKLHL
FCEESRRLNDWVPEISLPER
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcagttccccggaagagccctgaaggaggcgctgctgtgcgcccagagtgaaggccgg
cttactgctggagtgtacgagagcgccaagatcatgactgaagacccggacagcgtgtcc
ttctgtgtgctggccatggacgagcagttccagtgtgacatcgctctgcagatccacttc
actctcatccagtctttctgcttcgacaacgacatcagcatcgtcagagtgagcgacatg
cagcgtctggcagacattgtcggagacaagtcggaggagctggaagacgcgcactgcgtc
ctcatcacgaaccccgctgacgggtcctgggaggagccggctctggagaagctgcacctg
ttctgcgaggagagccgccgcctgaacgactgggttcctgagatcagcctccccgagcgc
tga

KEGG   Oryzias latipes (Japanese medaka): 101162606
Entry
101162606         CDS       T02443                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101162606
   04068 FoxO signaling pathway
    101162606
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101162606
   04210 Apoptosis
    101162606
   04115 p53 signaling pathway
    101162606
   04218 Cellular senescence
    101162606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101162606
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101162606
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101162606
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101162606
NCBI-ProteinID: XP_004072265
UniProt: A0A3B3HQ36
LinkDB
Position
9
AA seq 159 aa
MTLEEINGQENTMANADRVQSAGAALEELLLAAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGADETGEPKDVHCIL
VTSPSANPWKDPSLDKLSLFCEESRNAYDWVPTITLPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggagatcaacggacaagaaaacacaatggcaaacgctgatagggttcag
agtgcaggcgcagccctggaggagctgctgctcgctgcaaagaagcaggactacctgaca
gttggagtttacgaatccgctaaagtcatgaatgttgatccagacagcgtggcgttctgc
gtgctcgccaccgatgaggagtacgagtgtgacatcgcccttcagatccactttaccctc
atccaggcgttctgcttcgacaacgacatcaacgtggtgcgcgtcaacgatatcgagcgc
ctggccgacctcgtgggcgcagacgagaccggcgagcccaaggacgtgcattgcattctt
gtcacgagccccagtgcaaacccgtggaaagacccctcactggacaagctgagtctgttc
tgcgaggaaagccgaaatgcctacgactgggtgcccacaatcacgctaccagaacgctga

KEGG   Oryzias latipes (Japanese medaka): 101163042
Entry
101163042         CDS       T02443                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101163042
   04068 FoxO signaling pathway
    101163042
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101163042
   04210 Apoptosis
    101163042
   04115 p53 signaling pathway
    101163042
   04218 Cellular senescence
    101163042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101163042
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101163042
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101163042
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101163042
NCBI-ProteinID: XP_004082280
LinkDB
Position
22
AA seq 216 aa
MPPPPAVLLKTCCNRTLCVCERDVCNLPTTFNAKPAGKDGEKVQTTRLLLRFYAPEIPLG
FEDSTSGRNCDSLENRMQSVSLALEELLVSSQEQNCLTVGIYESAKFLNVDPDSVVLCVL
AADHEEDVALQIHFTLLQSFCCNSGITILQVSGIQRLHQLLGAADVNKDQDERKDLHCLL
VTNPQANHCRLQEVGAYCQESLRPDQWVPTLILQER
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcctccgcccccggctgtccttttaaaaacgtgttgcaaccggactctgtgtgtgtgt
gagagagacgtctgcaatttgccaacaacattcaatgcaaaacctgcaggcaaagacggt
gaaaaagttcaaactaccaggctgctgttgcgcttttacgcgccggaaatacctttagga
tttgaagactcgacttctggcagaaactgtgactctttggagaacaggatgcagtctgtg
agcctggccctggaggagctgctggtgtcatctcaggagcaaaactgcctgactgttggc
atctatgaatctgcgaaatttctcaatgtggatccagacagtgtggttctgtgcgtcctt
gcagccgaccatgaagaggatgtggcgctgcagatccacttcaccctgctgcagtccttc
tgctgcaacagtggtatcaccatcctgcaggtctcagggattcagcggctccatcagctt
cttggagctgcagatgtcaataaagaccaagacgagagaaaagacctccattgcttgctg
gtcacgaaccctcaggcgaaccactgcaggctgcaggaagtgggcgcatactgtcaggag
agtctacgtcctgatcagtgggttcctacactgatcctgcaggaacgctga

KEGG   Oryzias latipes (Japanese medaka): 101165223
Entry
101165223         CDS       T02443                                 

Gene name
gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101165223 (gadd45b)
   04068 FoxO signaling pathway
    101165223 (gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101165223 (gadd45b)
   04210 Apoptosis
    101165223 (gadd45b)
   04115 p53 signaling pathway
    101165223 (gadd45b)
   04218 Cellular senescence
    101165223 (gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101165223 (gadd45b)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101165223 (gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101165223 (gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101165223
NCBI-ProteinID: XP_004068187
UniProt: A0A3P9LNF6 A0A3B3HM80
LinkDB
Position
4
AA seq 160 aa
MTLEEVVGSSSTDKKMETVSQALEELLVAAQRQDCLTVGVYESAKLMNVDPDSVVLCLLA
TDEEDADDIALQIHFTLLQAFCCDNDINILRVSGMRRLAQLLGEDTENSNGNEPRDLHCI
LVTNPPVQPLQCQALQDVSSFCAESRCRNLWVPCLELKDR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactcttgaggaggttgttggatccagcagtaccgacaaaaagatggagacggtgagt
caggctctggaggagttgctggtcgcggctcagaggcaggactgcctcacagtgggagtc
tacgagtccgccaaactcatgaatgtagatccagacagtgtggttctgtgtcttctcgcc
accgacgaggaggacgcggacgacatcgcgctgcagatccacttcacgctgctgcaggct
ttctgctgcgataacgacatcaacatcctccgggtgtccggcatgaggcgcctggcgcag
ctgctgggggaggacaccgagaacagcaacgggaacgagccccgggacttgcactgcatc
ttggtcactaacccccccgtgcagccgctccagtgtcaagctctgcaggacgtcagcagc
ttctgcgcagagagccgctgcaggaacctgtgggttccctgcttggagctgaaggaccgc
tga

KEGG   Oryzias latipes (Japanese medaka): 101174118
Entry
101174118         CDS       T02443                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101174118
   04068 FoxO signaling pathway
    101174118
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101174118
   04210 Apoptosis
    101174118
   04115 p53 signaling pathway
    101174118
   04218 Cellular senescence
    101174118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101174118
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101174118
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101174118
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101174118
NCBI-ProteinID: XP_004075174
UniProt: H2MIL9
LinkDB
Position
12
AA seq 154 aa
MTFEEVPIQKPTERAQCAGKALEEVLETAKDNESLTVGVYESAKVMNLDPDSVSFCVLAM
DEQFQCDIALQIHFTLIQSFCFDNDISIVRVSDMQRLADIVGDKAEELEDAHCVLITNPA
DGSWEEPALEKLHLFCEESRRLNDWVPEISLPER
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactttcgaggaggttccgatccagaagcccactgagcgcgcacagtgcgccggcaaa
gcgttggaggaggttctggagaccgccaaagacaacgagtccctcactgtcggtgtgtac
gagagcgccaaagtgatgaacctagacccggacagcgtgtccttctgcgtgctggccatg
gacgagcagttccagtgtgacatcgctctgcagatccacttcactctcatccagtctttc
tgcttcgacaacgacatcagcatcgtcagggtgagcgacatgcagcgtctggcagacatt
gtcggagacaaggcggaggagctggaagacgcgcactgcgtcctcatcacgaaccccgct
gacgggtcctgggaggagccggctctggagaagctgcacctgttctgcgaggagagccgc
cgcctgaacgactgggttcctgagatcagcctccccgagcgctga

KEGG   Oryzias latipes (Japanese medaka): 111946817
Entry
111946817         CDS       T02443                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111946817
   04068 FoxO signaling pathway
    111946817
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111946817
   04210 Apoptosis
    111946817
   04115 p53 signaling pathway
    111946817
   04218 Cellular senescence
    111946817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    111946817
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111946817
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111946817
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111946817
NCBI-ProteinID: XP_023807084
LinkDB
Position
22
AA seq 140 aa
MQSVSLALEELLVSSQEQNCLTVGIYESAKFLNVDPDSVVLCVLAADHEEDVALQIHFTL
LQSFCCNSGITILQVSGIQRLHQLLGAADVNKDQDERKDLHCLLVTNPQANHCRLQEVGA
YCQESLRPDQWVPTLILQER
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcagtctgtgagcctggccctggaggagctgctggtgtcatctcaggagcaaaactgc
ctgactgttggcatctatgaatctgcgaaatttctcaatgtggatccagacagtgtggtt
ctgtgcgtccttgcagccgaccatgaagaggatgtggcgctgcagatccacttcaccctg
ctgcagtccttctgctgcaacagtggtatcaccatcctgcaggtctcagggattcagcgg
ctccatcagcttcttggagctgcagatgtcaataaagaccaagacgagagaaaagacctc
cattgcttgctggtcacgaaccctcaggcgaaccactgcaggctgcaggaagtgggcgca
tactgtcaggagagtctacgtcctgatcagtgggttcctacactgatcctgcaggaacgc
tga

DBGET integrated database retrieval system