KEGG   Oryzias latipes (Japanese medaka): 100125451Help
Entry
100125451         CDS       T02443                                 

Gene name
tryp
Definition
(RefSeq) trypsinogen precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100125451 (tryp)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100125451 (tryp)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100125451 (tryp)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100125451 (tryp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100125451
NCBI-ProteinID: NP_001098370
UniProt: A4UWM7
LinkDB All DBs
Position
16
AA seq 242 aa AA seqDB search
MRSLVFVLLIGAAFALDDDKIVGGYECTPHSQPHQVSLNAGYHFCGGSLVNQNWVVSAAH
CYQSRVEVRLGEHHIRNNDGTEQFITSSRVIRHPSYNSYTIDNDIMLIKLSTPATLNQYV
QPVSLPSGCAPAGTMCLVSGWGNTMSPADDGDKLQCLNIPILSDSDCSNSYPGMITNSMF
CAGYLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAERNHPGVYAKVCIFSDWLDSTMA
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctctggtcttcgttctgctcattggagccgccttcgcccttgacgatgacaag
atcgtcggcgggtatgagtgcaccccccactcccagccccatcaggtgtctctgaacgct
ggttaccacttctgcggcggctctctggtcaatcagaactgggtggtgtctgctgctcac
tgctaccagtcccgagtggaggtgcgtctgggagagcaccacatccggaacaatgacgga
accgagcagttcatcacctcctcccgtgtcatccgccaccccagttacaattcctacacc
attgacaatgacatcatgctgatcaagctgagcactcctgccaccctcaaccagtacgtg
cagcccgtgtctctgccctccggctgcgctcctgctggcaccatgtgcttggtctctgga
tggggtaacaccatgagccccgccgatgacggcgacaagctgcagtgcctgaacatcccc
atcctgtccgacagtgactgcagcaactcctaccccggcatgatcaccaactccatgttc
tgtgctggatacctggagggaggcaaggactcttgccagggtgactctggtggccctgtt
gtgtgcaacgggcagctgcagggaattgtctcctggggatatggatgtgctgagaggaac
caccccggtgtctacgccaaggtctgcattttcagcgactggctggacagcaccatggct
agcaactga

DBGET integrated database retrieval system