KEGG   Oryzias latipes (Japanese medaka): 100170633
Entry
100170633         CDS       T02443                                 

Gene name
tp73
Definition
(RefSeq) tumor protein p73 isoform X2
  KO
K10148  tumor protein p73
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100170633 (tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    100170633 (tp73)
Transcription factors [BR:ola03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100170633 (tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 100170633
NCBI-ProteinID: XP_004070406
LinkDB
Position
7
AA seq 604 aa
MYYVKKKSQYNLLSSSMESLGSRATSASPYSSENASSSAVPTPSPYSQPNSTFEGLSPAP
AIPSNTDYPGPHDFQVSFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLVSSPPHGS
IIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQTAPANHLIRVEGNNLCQYVDDPVTGR
QSAYVPYETPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGR
ICACPGRDRKADEDHFREQQALNESVAKNGSANKRNFKQSPPNIPNPNMNMRKRRHGEEE
IYYIPVRGRENFELLMRIKDSLELVELVPQPLIDSYRHQTQQQMLQRPSNINSPSSYSPL
SNMNKIHSHGGLSKPSVNQMMGQQPQQHANSSMSHMGPNMLNNSHLQANGEMNSGHSNHN
IVSASHCSPPPSYNPDPSLVSFLTSLGCQNFIEYFTSQGLQSVYHLQTLSMEDLAALKIP
EQSRLVIWRGLQDMKQGVPVQLPPSAHHHDYHGQQLLRSSGNMAASAMAAIGSSGGELQR
QRVMEAVHFRVRHTITIPNRSGVGTAGMAAAADEWADFGFDMPDCKVSRNKHSIKEEFME
SDVH
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtactacgtgaaaaagaagtcccagtacaacttgctgagcagcagcatggagagcctg
gggagccgtgcgacgtccgccagcccctacagctctgagaacgcctcttcatcggctgtg
cccaccccttcaccttactcccagcccaactctacgtttgagggcctctcgcctgcccca
gcaatcccctccaacaccgattacccgggcccacacgacttccaggtgtctttccagcag
tccagcaccgccaagtctgccacatggacctactcccccctgttgaagaagctctactgt
cagattgccaaaacctgtccgattcagatcaagctggtgtcctctcctccacatggcagc
atcatcagagccatgccggtctacaaaaaggcagagcacgtgacagaggtggtcaaacga
tgccccaatcacgaacttggccgggactttaacgatggtcaaactgctccagccaatcac
ctgatcagagtggagggaaacaacctctgtcagtatgtggatgatcctgtcaccggcaga
cagagtgcctatgtgccctatgagactccacaggtggggactgagtttactaccatcctt
tacaattttatgtgcaacagcagctgtgtgggtggcatgaacaggagacccatcctcatc
atcatcaccttagaaaccagagatggccaggtgttgggcagaaggtcgtttgagggtcgg
atatgtgcgtgtcctggccgggaccgcaaagccgatgaagaccactttagggaacagcag
gccctgaacgagagcgtggccaaaaatggcagtgccaataaacgcaattttaaacagagt
ccaccaaatattcccaatccaaatatgaacatgaggaagaggcgacatggagaagaggaa
atttactatattccagttcgtggccgggagaactttgagctgctgatgaggattaaagac
agtttggagctggtggagctggtgccgcagccgctgattgactcctacagacatcaaaca
cagcagcagatgctgcagagaccgagcaacataaactcgccctcttcctattctccattg
tcaaacatgaacaagatccattcacacggaggcctcagcaagccatctgtcaaccaaatg
atggggcagcagccccagcaacacgccaactcctccatgtctcacatgggtccaaacatg
ctcaataacagccacttgcaggctaacggcgaaatgaacagtggccacagcaatcacaat
atagtgtctgcctcccactgcagcccgcccccttcatataaccctgaccccagccttgtc
agttttctcaccagtctgggctgtcagaacttcattgagtacttcacttcacagggtctc
cagtctgtttatcatctccaaactctatctatggaggatttagctgcactgaagataccg
gaacagtcccgcctagtcatctggcgagggctgcaggacatgaaacaaggtgttcccgtc
cagcttcctccttctgctcatcaccatgactatcacggccagcagttgctccgctccagc
ggcaacatggcagcctctgcgatggcagccattggttctagcggtggggagctgcaacgt
cagcgtgtcatggaagctgtgcactttcgagtccgccacaccataacgatccccaacaga
tccggcgtgggcacagcggggatggcagcagccgctgatgagtgggctgactttggcttc
gacatgcctgattgtaaagtgtcccgtaacaagcactccattaaggaggaattcatggaa
agtgacgttcactga

DBGET integrated database retrieval system