KEGG   Oryzias latipes (Japanese medaka): 100302438
Entry
100302438         CDS       T02443                                 

Definition
(RefSeq) thrombospondin-1a precursor
  KO
K16857  thrombospondin 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04145  Phagosome
ola04350  TGF-beta signaling pathway
ola04510  Focal adhesion
ola04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100302438
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100302438
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100302438
  09143 Cell growth and death
   04115 p53 signaling pathway
    100302438
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100302438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    100302438
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    100302438
   04990 Domain-containing proteins not elsewhere classified [BR:ola04990]
    100302438
Membrane trafficking [BR:ola04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100302438
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100302438
Domain-containing proteins not elsewhere classified [BR:ola04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   100302438
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA Laminin_G_3 cEGF EGF TSP1_CCN Laminin_G_2 Laminin_G_1
Other DBs
NCBI-GeneID: 100302438
NCBI-ProteinID: NP_001156590
UniProt: C5HIF5
LinkDB
Position
24
AA seq 1186 aa
MTRASTVLLLMLCSCEAARVAESRDDNSVYDLFELIRVPNKNHGVTLVKGDDPYSPAYKI
VNPDLIPPLPDGAFRDLIDSIHAERGFLLLLNFKQFKRTRGSILTVEKRDGSGPVLEIVS
NGKANTLDIVYSTENKQQVVSIEEVDLATGHWKNITLFVQEERAQLYVGCEEVNTAELDA
PIHSILTQETPPDIDSLESQTKLCFQGVLQNVRFVFGTTLEAILRNKGCQSSTSDTMILK
NLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKGLGVVVKELSNELRQLTDENK
LIKTRIGIHRGVCIHNGIVRKNRDEWTVDDCTECTCQNSATVCRKISCPLIPCANATVPD
GECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTRDCY
LQECDKRFKQDGSWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQLGGKQCEGEARQTQKC
QKSPCPINGNWGPWSPWDLCTLTCGGGVQTRKRLCNNPAPLYGGKECVGEATDRQMCNKK
ACPVDGCLSNPCFSGAKCTSFPDGSWKCGKCPNGYSGNGINCKDIDECKEVPDACFEFNG
VHRCENTDPGYNCLPCPPRYTGPQPYGQGIEEAAANKQVCTPRNPCLDGSHDCNKNARCN
YLGHFSDPMFRCECKPGFAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCPNLPNS
GQEDYDKDGIGDACDDDDDNDGIPDDRDNCPFVYNPRQYDYDRDEVGDRCDNCPYNSNPD
QADTDNNGEGDACAVDIDGDGILNEKDNCPHVYNVDQRDTDLDGVGDMCDNCPLEHNPDQ
VDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYISNANQVDHDKDGKGDACDHDDDNDGIP
DDKDNCRLAFNPDQLDSDGDGRGDACKEDFDLDNVPDIYDVCPENFDISETDFRKFQMVP
LDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTERDDDYAG
FVFGYQSSSRFYVVMWKQITQTYWSHKPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHTG
NTPGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVVMYEGKKMMADSGSIYDKTYA
GGRLGLFVFSQEMVYFSDLKYECRGMFNILPNTPKELPQMTQNTNY
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgacgcgcgcaagcaccgtgctgctgctgatgctctgctcctgtgaggctgcgagggtc
gcagagagccgagatgacaacagcgtgtatgacctgttcgagctcatccgcgtccccaac
aagaaccacggggtgactctggtgaagggagacgacccgtacagtcccgcctacaagatc
gtcaacccggacctgatccccccgctccccgacggtgcctttcgggacctgatcgactcc
atccacgcagagagaggattcctgctgctgctcaattttaagcagttcaagcggaccaga
ggcagcatcctgactgtggagaaacgcgacggctccggaccggtgctcgagatcgtctcc
aatggcaaagcgaacaccttggacatcgtctactccacggagaacaagcagcaggtggtc
tccatcgaggaggtggacctggccacgggccactggaagaacatcacgctgttcgtgcag
gaggagcgcgcgcagctgtacgtagggtgcgaggaggtgaacaccgccgagctggacgca
ccgatccacagcattctgacgcaggagaccccgccggatattgattccctggagtctcaa
actaagctgtgtttccagggggttcttcagaacgtgcgcttcgtgtttggcaccacactg
gaagccatcctgcgcaacaaaggctgccaaagctctacaagtgacaccatgatcctgaag
aatctcaacggttcctcagccatcagaactgagtacaccggacataaaaccaaagacctt
cagatggtctgtggcttctcctgcgaggacctgatcagcatgttcaaggagctgaagggt
cttggtgtggtggtcaaggagctgtccaatgaactccgtcaactgacagacgagaacaag
ctgatcaagacccggatcggcatccacagaggtgtttgtatccataacggcattgttcgc
aaaaaccgagacgagtggactgtggacgactgcaccgagtgcacgtgtcagaactccgcc
actgtgtgccgtaaaatctcctgccccttgatcccctgtgccaatgctacggtccccgat
ggggagtgctgcccccgctgtggaacaccaagcgattacgcagaggacggctggtcgcct
tggtctgaatggactcattgttctgtgtcgtgtgggcggggcattcagcagcggggacgc
tcctgcgatcgcatcaacaacaactgcgagggcacctctgtgcagacccgcgactgctac
ctccaggagtgtgacaagcgcttcaagcaggatggcagctggagccactggtcaccctgg
tcatcctgttctgtcacctgtggcgaaggagttatcacccgtatccgcctctgcaactct
cccactcctcagttgggaggaaagcagtgtgagggagaagctcggcaaacccagaagtgc
cagaagtctccatgtcccatcaatggaaactggggaccctggtctccgtgggatttgtgc
actctcacctgtggagggggtgttcagactcgtaagcgcctgtgcaacaatcctgctcct
ctttatggtggtaaggagtgcgtcggtgaggctacagacagacagatgtgcaacaagaaa
gcctgtcctgttgatggttgcttgtccaacccctgcttttctggagccaagtgcacaagt
ttccctgatggctcgtggaagtgtggaaagtgtcccaacggttactctggcaatggcatc
aactgcaaagatatcgacgagtgtaaggaggttccagatgcttgctttgagttcaacggc
gtgcaccgttgtgagaatacagatccaggctacaactgtttgccctgccctcctcgctac
acaggaccccagccgtatgggcaaggcatagaagaagctgctgccaacaaacaggtgtgt
acaccccgtaatccctgcctggatggaagtcacgactgcaacaaaaacgcccgctgcaac
tacctcggccacttctcagaccccatgttccgttgcgagtgcaagcctggctttgccgga
aacggacacatctgtggagaagacacagacctggatggatggcccaatgctgacctggtg
tgtgtggagaacgccacctaccactgtaaaaaggacaactgtcccaaccttcccaactcg
gggcaagaagattacgataaagatggaattggagatgcttgcgatgacgacgacgacaac
gacggcatccccgatgacagggataactgtccgttcgtgtacaatcccaggcagtatgac
tatgaccgcgatgaagtgggcgaccgctgtgacaactgcccttataacagcaaccctgac
caagcagacacggacaacaacggcgagggcgacgcttgtgcagtggacattgatggagat
ggaattctgaatgagaaggacaactgtccccacgtgtacaacgttgaccagagagacacg
gatttggacggagtgggagacatgtgtgataactgccctctggagcataatcccgatcag
gtggactcagatgatgatcgtgtgggagataagtgtgacagtaaccaggacattgacgag
gatggacaccagaacaacttggacaactgcccatacatctcaaatgccaaccaagtcgac
catgacaaagatggcaagggagatgcctgcgaccatgatgacgacaacgatggcatccct
gatgacaaagacaactgcagactggcttttaacccagaccagctggactctgatggtgac
ggccgtggagacgcttgcaaagaagactttgatctagacaacgtgcctgacatctatgac
gtgtgtccggagaactttgacatcagtgagacggacttccgtaaattccagatggttcca
ctggatccgaaaggaacatcccagatcgatccgaactgggttgtccgacatcaaggcaag
gagctggttcagactgtcaactgtgaccctggcattgctgttggttaccacgagttcaac
tcagtggacttcagtggaactttctttattaacacggaacgagatgatgactatgctggt
ttcgtattcggttaccagtcgagttccaggttctacgtggtgatgtggaaacagatcacg
cagacctactggtcccataaacccacaaaagctcagggctactctggcttgtccatcaaa
gtggttaattctactaccggtccaggggagcatctcaggaatgccttgtggcacacaggc
aacaccccaggacaggtccgcacactgtggcatgacccgaagaacgttggatggaaggac
ttcactgcctacagatggcacctgatccaccgaccaagaacaggactcattcgagttgta
atgtatgaaggaaaaaagatgatggcggactctggaagcatctatgacaagacgtacgct
ggcggcaggctaggtctctttgtcttttctcaggagatggtctatttctctgacctgaag
tatgaatgcagaggtatgtttaacatattacctaacactcctaaagagttgccccagatg
acgcaaaatacaaattattga

KEGG   Oryzias latipes (Japanese medaka): 100302441
Entry
100302441         CDS       T02443                                 

Gene name
thbs1
Definition
(RefSeq) thrombospondin-1 precursor
  KO
K16857  thrombospondin 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04145  Phagosome
ola04350  TGF-beta signaling pathway
ola04510  Focal adhesion
ola04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100302441 (thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100302441 (thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100302441 (thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100302441 (thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100302441 (thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    100302441 (thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    100302441 (thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:ola04990]
    100302441 (thbs1)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100302441 (thbs1)
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100302441 (thbs1)
Domain-containing proteins not elsewhere classified [BR:ola04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   100302441 (thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA cEGF TSP1_ADAMTS Laminin_G_3 EGF TSP1_CCN Laminin_G_2
Other DBs
NCBI-GeneID: 100302441
NCBI-ProteinID: NP_001156600
UniProt: C5HIF4
LinkDB
Position
22
AA seq 1216 aa
MMLCGIFLLFMLWSSDGARLAESRDDNSVYDLFELARINKRNHGVSLVKGADPYSPAYKI
LNADLIPQVPDGSFRDLLDSIQAERGFLLLLNLKQYKRSRGTMLSIEKTDGSGPVFEIIS
NGKANTLDVVYATENQQQVVSIEDADLATGHWKNITLFVQEDRAQLYVGCEEINVSEMDA
PIQTVLSREVADIARLRIGKGSARDKFMGVLQNVHFVFGTSLDAILRNKGCQSGATLTDV
MRLDNPVNGSSPAIRTDYTGHKSKDLQTVCGFSCEDITSMFKELRGLNVIVKQLSNELEK
VSTESQLLKNQINIHRGVCLHNGIVHNDKDEWTVDDCTECTCQNSATVCRKISCPLIPCA
NATVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSTTCGRGIQQRGRSCDRINSKCEGTSV
QTRDCYLQECDKRFKQDGGWSHWSPWSSCSVTCGEGVMTQIRLCNSPTPQMGGTDCQGKG
RQTKTCKKSACPINGGWGPWSPWDTCSVTCGGGIQTRKRLCNDPVPKYGGKECIGDAAMP
QICNKQECPIDGCLSSPCFPGTKCTSSPDGSFTCGKCPLGYAGDGVICKDIDECKEVPDA
CHTHNGIHRCENTEPGYNCHPCPARFSGPQPYGRGVEQATANKQVCTPRNPCKDGSHDCH
KNSDCIYLGVYSESMFRCECKPGYAGNGRICGEDSDLDGWPNTDLQCVANATYHCKKDNC
PNLPNSGQEDHDKDGLGDECDNDDDNDGIPDVRDNCPKVYNPAQYDADRDDVGDQCDNCV
FEANTDQTDTDNNGEGDACAIDIDGDGILNENDNCPYVYNVDQRDTDRDGVGDHCDNCPL
EHNPDQVDSDSDRVGDKCDNNQDIDEDGHQNNMDNCPYIANANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQLDSDNDGRGDVCKDDFDQDSVLDIHDVCPENFAISETDFR
RFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDEFSAVDFGGTFFVNTDR
DDDYAGFVFGYQSSSRFYTVMWKQITQTYWSHTPTRAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGDTPGQVRTLWHDPKNIGWKDFTAYRWHLTHRPKTGLIRVTMYEGKRIMADSGNI
YDKTYAGGRLGLYVFSQEMVYFSDLKYECRGKQRLPNCALQMRFVITRAFIIDHVFSVFT
FRYIRREEEYSSSNGT
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgatgctgtgtggcatctttctgttgttcatgctgtggagcagtgatggagcgaggctg
gcagaaagtcgggatgataacagcgtctatgacttatttgagctggctcggattaataaa
agaaaccatggagtgagtttggtcaaaggagcggatccttacagccccgcatacaaaatc
ctgaacgcggacctgatcccccaagtccccgatggttccttcagggacctcctcgactcc
atccaggctgagagaggcttcctcctgctgctcaacctgaagcagtacaagcgatcccgg
ggcacgatgctcagcatcgagaagaccgacggatccggacccgttttcgagatcatctcc
aacggaaaggccaacaccctggatgtggtgtacgccaccgagaaccagcaacaggtggtg
tccatcgaggacgcggacctggccacagggcattggaagaacatcacgctgttcgtgcag
gaggacagggcgcagctgtacgtgggctgtgaggagatcaacgtgtcggagatggacgcg
ccaatccagacggtgctgtcccgggaggtggctgacatagctcgactaaggatcggaaag
gggtcagcaagagataaattcatgggagtgctccagaatgtgcactttgtctttggtacc
tctctggatgcaatactgagaaataagggctgccaaagtggggcaactttaaccgatgtc
atgagactggacaacccagtcaatggctctagccctgccatcaggaccgactacacaggt
cacaaatccaaagacttgcagactgtctgcgggttttcttgtgaggacatcaccagcatg
ttcaaggagctcaggggactcaatgtgattgtcaaacagctgtcgaacgagctcgaaaaa
gtgtccacagaaagccagctcctgaaaaatcaaattaacatccacagaggagtctgcctc
cataatggcattgtacacaacgacaaagatgagtggacagtggacgactgcacagagtgt
acctgtcagaactctgctactgtgtgccgtaaaatctcctgccctctgatcccgtgtgct
aatgccaccgtgcctgatggcgaatgttgtcctcgctgtggaacaccgagtgattatgca
gaagatggctggtccccctggtctgaatggacccattgctccaccacctgcgggcgtggc
atccaacagcgcggacggtcatgtgaccgcatcaacagcaagtgtgagggtacctctgtc
cagacccgggactgctacctgcaggaatgtgacaagcgcttcaaacaggatggaggatgg
agccactggtcaccctggtcttcatgctctgtgacctgtggcgagggagtcatgacccaa
atccgcctctgcaactcccccacaccacagatgggaggaacggactgccagggaaaggga
cgtcagaccaaaacttgcaagaagtccgcctgtcctattaatggaggttggggaccttgg
tcaccatgggacacctgctctgtcacctgtggaggaggaatccaaactcgaaaacgcctc
tgcaatgatcctgtgcccaaatatggtggaaaagaatgcattggtgacgctgccatgcct
caaatttgcaacaaacaggaatgcccaatcgatggttgtctttccagtccgtgctttcct
ggaacaaagtgtaccagctctccagacggctccttcacatgtggaaaatgtcctctgggc
tacgctggtgatggggttatatgcaaagacattgatgaatgcaaagaagttccggatgct
tgccacactcacaatggaattcatcgttgtgagaacactgagccgggatacaactgtcat
ccttgccctgcgcgtttctctggtcctcagccctacggaagaggagtggagcaggcaaca
gctaataaacaggtttgcactcctcgtaacccttgcaaagatggcagccatgactgtcat
aaaaattcagactgcatctacttgggcgtgtactccgagtccatgttccgctgtgagtgc
aagccaggatacgctgggaatggccgcatatgtggagaggacagtgacctggacggatgg
cccaacactgacctacagtgcgtggcaaacgccacgtatcattgcaaaaaggataactgc
cctaaccttcccaactctggccaggaagatcacgacaaagatggcctgggtgatgaatgt
gacaacgatgatgacaatgatgggatccccgatgttagagacaactgccctaaagtttac
aacccagcccagtatgatgcagaccgggacgatgttggggatcagtgtgacaactgtgtg
tttgaagccaacacagaccaaacagacactgacaacaacggagagggcgatgcctgtgct
attgacatagatggtgatgggattctgaatgagaatgacaactgcccgtatgtttacaac
gtggaccagagagacactgacagggacggggtgggagatcactgcgataactgccccctg
gaacacaatccagatcaggttgattctgactcagatcgtgtgggagataagtgcgacaac
aaccaggacattgacgaagatggtcaccagaacaacatggacaactgcccgtacattgct
aatgccaaccaggctgaccatgacaaggatggcaaaggtgatgcctgcgaccatgatgat
gacaatgatggcatcccagatgacaaggataactgcaggctggcctttaaccccgatcaa
ctggactcagataatgatgggcgtggtgatgtgtgcaaagatgattttgaccaagacagt
gttctggacatccacgatgtgtgccccgagaactttgcaatcagtgaaactgacttccgc
aggttccagatggttcctctcgatcccaaaggcacttctcagattgaccctaactgggtg
gtgaggcaccaaggcaaggagctggtacagactgtcaactgtgacccaggcatcgctgtt
ggttatgatgagttcagcgccgtggattttggcgggaccttcttcgtgaatacagacaga
gatgacgactatgcagggttcgtgtttggctaccagtccagttcccgcttctacaccgtg
atgtggaaacaaatcacacaaacgtactggtcccacactcccacaagagcgcagggatac
tctggcctgtcaatcaaagtagtcaactccaccacaggacctggtgagcatctgaggaat
gcactgtggcacaccggagacacccccggacaggtgcgcactttgtggcatgaccccaag
aacattggctggaaggactttactgcctacagatggcatctgacccacagacctaagacc
gggcttattagagtaaccatgtacgagggaaaaagaatcatggctgattctggaaacatc
tacgacaagacatatgccggcgggcggcttggcttgtatgtcttctctcaagaaatggtt
tacttctcagacctcaaatatgaatgtagaggtaagcaaaggctacccaattgcgcactt
caaatgcgatttgtcatcacacgagccttcattattgatcatgttttttccgtgtttact
ttcagatacataaggcgtgaggaagaatattccagttcaaacgggacatga

DBGET integrated database retrieval system