KEGG   Oryzias latipes (Japanese medaka): 100302444
Entry
100302444         CDS       T02443                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100302444
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    100302444
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ola03310]
    100302444
Transcription factors [BR:ola03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100302444
Nuclear receptors [BR:ola03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100302444
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100302444
NCBI-ProteinID: NP_001156605
UniProt: C4B4D0
LinkDB
Position
10
AA seq 777 aa
MDQGGVKKITYRRDDHLSKLVYTESPEEGGLLKVAPHSATSINSATSVVLPSSPLMQPGQ
VTNGLSSSPLPEELTPAPTSIGFLLDTQEPKDTTKAQRPQQAFQTQTSNRFGQQHLPQLE
TSIADSTESPMDSLIGGSDPNFFAMKTEDFSMDKVEQDPIDLDNAFDNIGKDVELNQKLF
NDTTLDLLQDFDLSGSPSDFYVGHDAFLSPMENDPFLVDGDIRGTSERDVKPSVAESNAA
IGAVSLASNGASLTSPEQCSPSLSTAASLASSNTLPALVKKEKDSDFIQLCTPGVIKQEK
ASAGHSYCQVSRTSSDTPGTTPISICGVSTSGGQSYHFGVNPRKTEAQQNDQKPVTGLYL
PITTIGGAWIRNQGAGNNSIHRASEAFSSSPNSASFASSTSRSEGGTPTSTGKTGTHKIC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKC
LMAGMNLEARKTKKLNRLKGCQNSNPPEMIPSPPVEARSLVPKCMPQLVPTMLSLLKAIE
PDTLYAGYDSTLPDTSTRLMTSLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSW
LFLMTFGLGWRSYQQCNGNMLCFAPDLVVNEERMKLPFMADQFEQMLKISNEFVRLQVSH
EEYLCMKVLLLLSTVPKDGLKSQAVFDELRMSYIKELGKAIVKREENSSQNWQRFYQLTK
LLDSMHEMAGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggatcaaggtggagtgaagaagataacatacagaagagatgaccatcttagcaaactg
gtctacactgaaagtcctgaggagggaggtcttttgaaagtggctccacacagtgccacg
tccatcaactctgccacgtctgtcgttcttccgtcaagcccgttaatgcagccgggacaa
gtgacgaacggtctcagcagcagtccccttccagaagagctcacccctgcccctaccagt
atcggctttttgctcgacactcaagagcccaaggacacgaccaaagctcaaagaccccag
caggcatttcagacgcagacatccaacagatttgggcagcaacatttaccccagttagag
accagtatagctgattcgacagagtcccccatggattctctcatcggaggatcagatccc
aacttttttgccatgaagactgaggatttttccatggataaagtagagcaggaccccatt
gatcttgataatgcgtttgataatattggcaaagatgtggaactgaatcagaagttgttc
aacgacacgactctggacctgctacaagactttgatctttctggatctccctccgatttt
tacgttgggcacgatgctttcctgtccccgatggaaaatgatccctttctcgtggacggg
gacattagagggacatcagagagagacgttaaaccatctgtggctgagagtaatgccgcc
attggggcagtctctcttgcctccaatggtgcgagcctgaccagtccagagcagtgcagt
ccaagcctgtctacagctgcttccttggcctcctcaaacactttgcctgctttggtgaaa
aaagaaaaagattctgacttcattcagctctgcacccctggtgtgatcaaacaggaaaag
gcatcagcgggccacagttattgccaagtgagcaggacctcttcggacacgccaggtacc
acccccatctctatttgtggggtaagcacttcaggaggacagagctaccactttggtgtc
aaccccagaaaaaccgaagctcagcagaatgaccagaagccagtgactggcttgtatctc
ccaataacaaccattggtggagcctggatcaggaaccagggtgctgggaacaactcaatc
cacagggccagtgaggctttctcaagctctcccaactccgcaagctttgcaagttccaca
tccaggtcagaaggaggcactcccacatccacaggaaagacagggactcataaaatctgc
ctggtctgctctgatgaggcgtccggctgtcactacggcgtcctaacctgcggcagctgc
aaagtcttcttcaagagagcagtggaaggccagcataattacctgtgcgctggaaggaac
gactgcattatagacaagatccggcggaaaaactgcccagcatgccgcttccgcaagtgt
ctgatggccggcatgaacctggaagctcgcaaaaccaagaagttgaaccgtttgaagggc
tgccagaacagcaacccgccagagatgatcccttcacctccagtggaggcccgctcactt
gttcccaaatgcatgccgcagctggtccccaccatgctatccctgctgaaagccatagag
ccggacactctctacgccggctatgacagcaccctgcctgacacctccacccgcctcatg
acctctctgaataggctgggcgggcgacaggtcatctctgctgtgaagtgggccaaggct
cttccagggttcagaaacctgcacctggatgaccagatgaccctgctgcagtgctcatgg
cttttcctcatgactttcggtttgggctggaggtcttaccaacagtgcaacggcaacatg
ctgtgctttgctccagacctcgtcgtaaatgaggagcggatgaagctgccctttatggct
gaccagtttgagcaaatgctgaagatttccaacgagtttgtgcggctccaggtttcccat
gaggagtacctgtgcatgaaggttctgctgctgctcagcacagtgccaaaggacggcctg
aaaagccaggcggtgtttgatgagctccgcatgtcctacatcaaagagctgggaaaagca
attgtgaagcgrgaggagaactccagccagaactggcaacgtttctaccagctcaccaag
ttgttggactccatgcatgagatggcgggaggattgctcagcttctgcttctacacctty
gtgaacaaatccctgagtgtggagtttccagagatgctggcagagatcatcagcaaccag
ttaccaaaattcaaagccgggagcgtcaagcctttgctcttccaccagaggtga

DBGET integrated database retrieval system