KEGG   Oryzias latipes (Japanese medaka): 100359365Help
Entry
100359365         CDS       T02443                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00590  Arachidonic acid metabolism
ola01100  Metabolic pathways
ola04370  VEGF signaling pathway
ola04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100359365 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100359365 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100359365 (ptgs2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100359365 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase hEGF EGF
Motif
Other DBs
NCBI-GeneID: 100359365
NCBI-ProteinID: NP_001165867
UniProt: D3KU78
LinkDB All DBs
Position
4
AA seq 607 aa AA seqDB search
MNSLRAVLLLLALGASVCEGGNPCCSWPCQNRGVCTSLGSDSYECDCTRTGYYGQNCSTP
EFFTWIKMTLKPTPNTVHYILTHFKGFWNIVNSISFLRDAIMSYVLTSRSHMIDSPPTYN
ADYGYKSWEAYSNLSYYTRTLPPVPEDCPTPMGVKGKKELPNAKELAEKLLMRRKFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKNGPAFTVAQGHGVDLSHIYGGNLARQHKLRLFKDGK
LKYQILNGEVYPPTVKEVGVEMHYPPHVQESQRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPYWDDERLFQTARLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNQRF
QYQNRISSEFNTLYHWHPLMPDSFHIEEKEYSYKEFVFNTTVLTEHGINKLVESFSHQIS
GRVAGGRNVPGPILYVAIKSIETSRQMRYQSLNEYRKRFNMKPYASFEDMTGEKEMAAVL
EEMYGHIDAVELYTGLLVEKPRHNGIFGETMVEMGAPYSLKGLMGNAICSPEYWKPSTFG
GSVGFDIVNTASLQKLVCDNVRGPCPLASLRVPDVKETGSSVINSSSSSRLADVNPAVFL
KERTTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacttagagctgtgcttcttctcttggctttgggcgcttcagtctgtgaagga
ggtaatccgtgctgctcatggccttgccagaacagaggtgtgtgcacaagtttgggttca
gacagttatgagtgtgactgcacccgcactggatattatgggcaaaactgctcaacgcct
gaattcttcacctggattaaaatgaccctgaagcccacccctaatactgtacactacatt
ctcacacactttaagggtttctggaacattgtcaacagcatctcctttctcagagatgcc
atcatgagttatgtgctgacatctcgatcacacatgattgatagcccccctacttacaat
gctgattatggatacaaaagctgggaagcctattccaacctgtcttactacacccgtacc
ttacccccagtgccagaggactgccctacccctatgggagtaaaaggaaaaaaagagctc
cccaatgctaaggagttggctgagaagctcttgatgaggagaaagttcataccagacccc
cagggcaccagcctcatgtttgccttctttgcacagcactttacccaccagttctttaaa
tctgatatgaaaaatggacctgcttttactgtggctcaaggtcatggggtggatctcagc
cacatctatggaggcaacctggcgaggcagcataaactcagactcttcaaggatggcaag
cttaaatatcagatactaaatggagaggtgtatcccccaactgttaaggaagtaggtgtt
gaaatgcactacccgcctcatgtccaggagtctcagcgcttcgctgtcggccacgaggcg
ttcggcctggtccccggcctcatgatgtatgccaccatctggctccgtgaacataaccga
gtgtgtgatgttttgaaagaggtccacccctactgggatgatgaaagacttttccagact
gcacggctcattcttatcggtgagaccatcaaaattgtgattgaggactacgtgcagcac
ctgagtggctacaacttcaagctgaaatttgatccggagcttctcttcaatcaacgcttc
cagtaccaaaaccgcatctcatccgagttcaacacactctaccactggcacccactgatg
cccgatagtttccacatcgaggaaaaagagtatagctataaggaatttgtcttcaatacc
acagtgctgactgagcatggcatcaacaaactggtggagtccttcagtcatcagatatct
ggacgggttgctggtggtcgtaacgtcccaggacccatcttgtacgtggccataaagtcc
atagagaccagcagacaaatgcgttaccagtcactcaatgaatacagaaagcgtttcaac
atgaagccctatgcgtcttttgaggacatgacaggagagaaagaaatggctgcggtgctg
gaagaaatgtacggacacattgatgctgtggaactctacacaggactactggttgagaaa
ccccgccacaacggcatcttcggggagacgatggtggagatgggagccccttactcactt
aaaggtttaatggggaatgccatttgctctccggaatactggaagcccagtacttttgga
ggcagcgtaggcttcgacattgttaacacggcttctttgcagaagctcgtttgtgacaat
gtcaggggtccttgtcctctggcatccttacgtgtacctgatgtgaaagagacgggatcc
tcggttatcaacagttcttcaagctctcgcctagcagatgtcaaccccgctgtctttctg
aaggaaaggactactgaactataa

DBGET integrated database retrieval system