KEGG   Oryzias latipes (Japanese medaka): 100529196
Entry
100529196         CDS       T02443                                 

Gene name
serpine1
Definition
(RefSeq) plasminogen activator inhibitor 1 precursor
  KO
K03982  plasminogen activator inhibitor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100529196 (serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100529196 (serpine1)
   04218 Cellular senescence
    100529196 (serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    100529196 (serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    100529196 (serpine1)
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    100529196 (serpine1)
Peptidases and inhibitors [BR:ola01002]
 Peptidase inhibitors
  Family I4: serpin family
   100529196 (serpine1)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100529196 (serpine1)
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100529196 (serpine1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100529196
NCBI-ProteinID: NP_001188451
UniProt: D7UTX2
LinkDB
Position
18
AA seq 391 aa
MICVSVFLLLTLTRAGLGSLQEKQNDFGLKVFSQVAEDSVDQNLALSPYGVASVMAMAQL
GADGDTYRALTAAMGFSLRDRGMPRQQRFLQRDLASEEGVNIASGVMVERKMSLEKGYRR
ALAKTFQTYPHQVDFTKSDQAVNIINAWVSDHTAGSIQDFLASGSLSDETRMVLLNALHF
QGLWKVPFNPKLTQERMFHCANGSKVPVPMMRLTNRFNYGEFVTSDGVDYDVIEVPYEGD
TLSMLLVSPFEHDVPLGMLSADLSSQKIRQWRSEMRKVNRQLAMPRFSLNSEVNMKTALH
KMGLGDMFNLATADFTRITSDERLCVSKVLQRVTIEVNEQGTKAAAATAAVMFSRMAVEE
IILDRPFLFLIQHKSTGVVLFMGHFNQPEHQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgatttgtgtgtccgttttcctgctgctgaccctgaccagagcggggctcggctccctg
caggagaagcagaatgactttggcctgaaggtcttctctcaggtggctgaggactccgtg
gatcagaacctggccttgtcgccgtatggtgttgcctctgtcatggccatggcgcagctt
ggcgctgatggagacacctacagggccttgactgcagccatgggcttttctctgagagat
cgcgggatgcctcggcagcagcggttcctgcagcgggacctggccagtgaggaaggggta
aatattgccagtggggtgatggtggaaagaaagatgagcctggaaaagggataccgccgg
gccctggccaagaccttccagacctacccccaccaggtggacttcacaaagtcagaccag
gctgtcaacatcatcaatgcctgggtctctgaccacactgcaggttcgatccaggacttc
ttggcatctggatctctgagtgatgagacccgcatggtcctcctgaatgccctccatttc
cagggcctgtggaaggttcccttcaaccccaaactgacacaggagaggatgttccactgc
gccaacggcagcaaggtgccagtaccaatgatgagactcacaaaccgcttcaactatggg
gaatttgtgacttctgatggggtggactacgatgtgattgaagtgccatatgagggcgac
acattgagcatgctgctggtgtcaccttttgagcacgatgtgccactgggcatgctcagt
gcagatctgagcagccagaaaattaggcagtggaggtccgagatgaggaaggtcaaccgg
cagctggccatgccgaggttttctctgaactctgaagtgaacatgaagactgctctgcat
aagatgggactgggagacatgttcaacctggccactgctgacttcacacggataacctct
gatgagaggctctgcgtgtccaaagtcctgcagagagtaacgattgaggtgaacgaacaa
ggaaccaaggcagcagctgccacagctgccgtgatgttctctcgcatggccgtggaggag
atcatactggaccgaccattcctctttctcattcagcacaagtccacaggtgtcgttctc
ttcatgggtcacttcaaccaaccggaacatcagtga

DBGET integrated database retrieval system