KEGG   Oryzias latipes (Japanese medaka): 101154931Help
Entry
101154931         CDS       T02443                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101154931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ola01002]
    101154931
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101154931
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101154931
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101154931
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101154931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101154931
NCBI-ProteinID: XP_011471628
UniProt: H2N2L4
LinkDB All DBs
Position
16
AA seq 245 aa AA seqDB search
MKFFILLALCAAAYAAPLEDDKIVGGYECRKNSVPYQVSLNVGYHFCGGSLISSTWVVSA
AHCYQSRIQVRLGEHNIAVNEGTEQFIDSVKIIRHPSYSSWNLDNDIMLIKLSTPASLNS
YVSTVSLPSSCAAAGTSCLISGWGNTSASGSNYPDRLMCLDAPILSDTNCRNSYPGEITS
NMFCAGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQKNRPGVYTKVCNYNTWIRN
TMSSN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttcattctcctagccctttgtgctgcagcatatgctgctcctcttgaggat
gacaagatcgttgggggttacgagtgcaggaagaactctgtgccctaccaggtgtctctg
aatgtgggataccacttctgtggaggctccctgatctccagtacctgggtggtgtctgct
gctcactgctaccagtctcgtatccaggtgcgtcttggtgagcacaacattgctgtgaat
gagggaaccgagcagttcatcgactccgtcaagatcatccgccaccccagctacagcagc
tggaacctggacaatgacatcatgctgatcaagctgagcacgcccgccagcctgaacagc
tatgtgagcaccgtgtctctgccctccagctgtgctgctgccggcacctcctgcctgatc
tccggatggggaaacaccagcgccagtggaagcaactaccccgaccgcctgatgtgcctt
gatgcccccatcctgagtgacaccaactgcaggaactcctaccccggcgagatcacctcc
aacatgttctgtgccggtttcctcgagggaggaaaggactcctgccagggtgactccggt
ggccccgtggtgtgcaacaaccagttgcagggcatcgtgtcctggggttatggctgtgcc
cagaagaacagaccgggagtctacaccaaggtctgcaattacaacacctggatccgcaac
accatgtcctccaactaa

DBGET integrated database retrieval system