KEGG   Oryzias latipes (Japanese medaka): 101155032Help
Entry
101155032         CDS       T02443                                 

Definition
(RefSeq) envoplakin
  KO
K10383  envoplakin
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Cytoskeleton proteins [BR:ola04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    101155032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plectin Spectrin Turandot
Motif
Other DBs
NCBI-GeneID: 101155032
NCBI-ProteinID: XP_011476844
LinkDB All DBs
Position
8
AA seq 2033 aa AA seqDB search
MSKKKELSSVKISRSQASDLAIVIARMQKNADQVEKNVLRVEHLLSVDKEREQKNQEHLH
QKENADNLAQAEELLKNLFLDVDKAKKLKHPQSNEIERDVKNLHERWVRGFAAYRDLYDP
VPNLQLPPKTDWRALLDEKQGQLRSDYGPKVSDVEKQIAEHNILHQEVEAYGDQLQPSST
PSKEQYSALKEKHFELLESSKLRQKHLASLYEYLQKCTKELVYLSGQQEKIMHRDWSDRM
VDPAGVRTEYEKFKSHSLLAHEEEVQQLLKDGDDLMEAGHPGAVAVQVHKDMVQFEWQAF
LNLCLAQETHLDNIDIYKKFQLDAETLSHSLERLSSTLDPQSLSNKSNPEILLALEGDEP
SLRRNEQRLASLKERSSSIPPLKLRRVQPRKPTPVISLCDWTNEEDVVTRDDQLILKSNF
DGNNWELQNRSGKIKTLPGVCFLIPPPDAEALETVDRLDRKLADLKSQRAALMASLRTPV
VEVDHPQKAAVLQSSPEEIQAAELLKDLERINRALEESQEDILKRLRTPLDNRNPTQDLA
RRHQEHEKSAATVRALESEKSTIQRKLDPALAKKPLGPKASILPAKLNSANNKIDNIETL
IDLYNKKATASMFLERQIQHVEDLVSGFEKKLVEDGTILNKPSALENRKQEIQDVQKEVF
SAKDELVKLGKDLDLTKKPCSSVQQTLGEYCPDIQRQENQVNQLKNRYANIKNQLQDRLA
LLQRAINRSRDFQNAVSSLDYALLNLPNNSANSTDGVAQIITKEKSQKKVVEDIEKKTKD
LAQIKALSKDLQRRLNEYDMKSVTYRRSLNNEDDSEEDQEEEQVITKSRTLAQRVQRTEQ
ELLNLFSEVSAENKERLCQLETAKNIMARKEENISQVAVSQQLQLQNQMVDHQESESLKK
ELSEEMNRRLCAQRDLETYQKRFVSLKSRRGVERLEEKEVVQYYRDPKLESELRSLKTRI
QDEDLKRSKIQTEIKEINEKMIQTEVQLTKVEPKLVTKVLTEYERDPKLDKEAAKIRDEM
QKIKQELQTRESETVHVKTELTVLAQKKPNIREKIVQKEVVRLEKDPDMMKAVLVLKNLI
EEEELMFKSLNDNIFSIRGQVNTLERVIPTIQPKIVTKVVKEVQQDPEMLEESRKLKMLL
EEEKDEIVILKKDLTTLQLQHTELEKLKPKVELKELIHQIYRVDPETEVELRRLKKELQD
LGRGRADKETKMEEVLATLAILRKQKPKVEYKEVTQEVIKEEKSPEVVRELQRLNNQATR
LRVNCDTTLELLAHLRKERDELKAEKSKVETKLVTKELIKYEDDPLLLKEADRFRRDVRE
EIHQRRILEECLFDLQNKYISLEREKPEEKTTCIPVVRYQNDPMQIQQHEKLNRNLDEEV
KGRRKLELEVRKLRGLVQDKETNLAESDDRQRKIQAEAELRKIKARILELENTPPPVEEK
IIIEEVLKVERDPKLEKLTDDVRANLETESTKVSDLERELRNLQLRLELLQKEKSIEKVV
YREVVRVEKDPTVEAERDRLRDLVSKERNHRRDLEDNVQRITIQINQLSTSKSMKSQEEA
AIASQKEALQKEKEDLLKQLKALESQRSSINITFQQQSKLLSEKNQLAHQRSLKTSSEVE
RLEKQILNEKDKIHQKETLIAELLKSIKKEEHSEIHTRETNLSTKITILDPETGKDMSPY
NAYLLGLIDRDQYLKLTELECDWEEITSSGPDGDISILQDRKSGKQYSINDALKDGRLTE
TDFKRFKDRKMPISEFALIVAGEPQKPYIPPPQERLNKSIPATQTSPLNSMIPSLRSSQT
NLNSHLNGSLNDLSAAAVEEHFPISGIFDMTTESRMSVRSAMTRKLIDAETGLKLLEAQA
ASGGIVDLTKKDKLSVHKAVQNHLIDSSHMHKLLNAQKAFTGVEDPVSKVRLSTSQAAQK
GYIPPENAKRYLEAQYLTGGLVNPSKPGRLTIQEALATRMIDSKAAEELQDEAFHTKELV
DPITKQNISYKQAMDRCKKDPSTGLLLLPVVSTDAENTPSYSNYRFHSPHSKV
NT seq 6102 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaaaaaggagttaagttctgtcaagataagcaggagtcaggccagcgatctg
gccattgtgatcgctcgcatgcagaagaatgcagaccaggtggagaagaacgtcctgcga
gtagaacaccttctgtctgtggacaaggagcgagagcagaagaaccaggagcacctccat
caaaaggagaacgcagacaacctggcgcaggccgaagagctgctgaagaacctcttcctt
gatgtggacaaagccaagaagctgaagcaccctcagtctaatgagatagaaagagacgtg
aagaatctccacgagcgctgggtgaggggcttcgctgcctacagggatctgtacgaccca
gttcccaacctgcagctgccgccgaagaccgactggagggctttgcttgatgagaaacag
ggccagttacggtcagactacggccccaaagtgtctgatgtggagaagcagatagcagaa
cacaacattcttcaccaggaggtggaggcctacggtgaccagctacagcccagcagcacc
ccctccaaggagcagtactccgccctcaaagagaaacactttgaactacttgaaagctcg
aagctccggcagaaacacctggcctctctgtacgaatacttgcagaaatgcaccaaggag
ctggtctacctgtccggccagcaggagaagatcatgcacagggattggagcgaccggatg
gtggaccccgcaggcgttcgcacagaatacgagaaattcaaatctcacagtctgctcgcg
catgaggaagaagtccagcagctgctgaaggatggagacgacctgatggaagcaggacac
cccggagccgtggctgtacaggtacataaggatatggtgcagtttgagtggcaggccttc
ctcaacctctgcttggcccaagaaacccacctggacaacatcgacatctacaaaaagttc
cagctggatgcagagacgctgtcccattctctggagagactcagctccactctggaccct
cagtctctgagcaacaagagcaaccctgagatcctgctggccctggagggagacgaaccg
tctttgaggaggaatgagcagcgcctggcttctctgaaggagcgcagcagcagcatccct
cctctgaagttacgcagagtccagcccaggaagcccacccctgtgatctccttgtgtgac
tggaccaatgaagaggatgttgtgacacgtgacgatcagctgatcctcaagtccaacttt
gatggaaacaactgggagcttcagaacagaagtggaaagatcaaaaccctccctggggtg
tgttttttgatcccaccccctgatgctgaggctttggagactgtcgacaggctggacagg
aagttggcagacctgaagagccaaagagctgccctgatggcctctttgaggactcccgtg
gttgaggtggaccatcctcaaaaagcagctgttctgcaaagttctccagaagaaatccaa
gctgcagagctcctcaaggatctggagcggatcaacagagccctggaggagagccaggag
gacattctgaagagactgaggacccctctggataaccgcaaccccactcaagatctagca
aggagacatcaggagcatgagaaatctgctgcaacagtccgagcgctggagtctgagaag
tccaccatccaaagaaagctggatcccgccctggccaagaaacctctggggcccaaagcc
tccatccttccggccaaactaaactctgccaacaacaagatcgacaacatcgaaactctc
atcgatctctacaataaaaaagcgacagcctccatgttcctggaaaggcaaatccaacat
gtggaggacctggtttctgggtttgagaagaagcttgttgaagatggaaccattcttaat
aaaccttctgctctggaaaaccgtaaacaggaaattcaggacgtacaaaaggaggttttc
tcagcaaaggacgagctggtgaagctgggcaaagatctggacctgacaaagaaaccatgc
agctccgtgcagcagactttaggggagtactgccccgacatccagcgccaggagaaccag
gtcaatcagctgaagaaccgctacgcaaacatcaaaaatcagctgcaggacaggttagct
ctcctacagcgagcaatcaacagaagtcgagacttccagaatgctgtttcttcactggat
tacgcactgttaaatttgccgaacaactctgcgaatagtaccgatggtgttgctcagatc
atcaccaaggagaagtcccagaagaaagtggtggaggacatcgagaagaagacgaaagat
ttagcccaaataaaggccctttccaaagatctgcagagacgcctgaacgaatatgacatg
aagtcagtgacttaccgcaggagtctgaacaatgaagatgactctgaggaggaccaagag
gaagaacaggtcataacaaagtctcgaactttggctcagagagttcagagaacggagcaa
gagctgctgaaccttttctctgaagtttccgctgaaaacaaggagcgcctctgtcagctg
gagacagcgaagaacatcatggcgaggaaggaagagaacatcagtcaggttgctgtcagt
caacagctgcagcttcagaaccagatggtggaccatcaagaatctgaaagtctgaaaaag
gagttaagcgaggagatgaacaggcgcttgtgtgcacagagagacctagagacataccaa
aagaggtttgtgtctctgaagagcaggagaggggtggagaggttggaggagaaggaggtg
gtccagtactaccgcgaccccaaactagagtcggaactcaggtctcttaaaaccagaatc
caagatgaagatctgaagagatccaaaatccagactgagatcaaggagattaacgagaag
atgatccagacagaggtccagctgacaaaggtcgaacccaaactggtgaccaaagtgctc
accgagtatgagagagaccccaagctggacaaagaggctgcaaagatcagagacgagatg
cagaaaataaagcaggagctccaaaccagggagtcagagacggtccatgtgaaaaccgag
ctcacggttctggcccagaaaaaacccaatatccgagagaagattgtacagaaggaggtg
gtaagactagagaaagacccagatatgatgaaagctgtgttggtgctcaagaacctcatc
gaggaagaagagttaatgttcaagtctctgaatgacaacatctttagcatcaggggccag
gtgaacacgctggagagggtcatccccaccatccaacccaagatcgtcaccaaggtggtc
aaagaagtgcagcaagatccagaaatgctggaggagtccaggaagctaaagatgctcttg
gaggaggagaaggatgagatcgtaatcctcaagaaggatctgaccactttgcagctgcag
cacacagagctggagaagctcaagccaaaggtggagctaaaggagctcatccaccagatt
tacagagtcgatcctgaaactgaggtggagctccgtcgcttgaagaaagagctgcaggat
ttgggcagaggccgcgccgacaaagagacaaagatggaagaggtgttagcaactctggcc
atcttacgtaagcagaaacccaaagtggagtacaaggaggtcacccaagaggtgatcaag
gaagagaagagcccagaagtggttagggagctccaacgtctgaacaaccaagccacccgt
ttgagagtcaactgtgacaccaccttggagctgctagcccatctacgcaaggaaagagat
gagctgaaggcagaaaaatccaaagtggagacgaagcttgtcacgaaagagctcatcaaa
tatgaagacgatcctcttctgctgaaagaggctgatcgatttcgcagggatgtaagagag
gagatccaccagcggcgcatcctggaggaatgtctgtttgatctccagaacaagtacata
tcactggaaagagagaagcctgaagagaagaccacctgcattcccgtggttcgctatcaa
aacgaccccatgcagatccagcagcacgaaaagttaaacaggaacctggacgaggaagtg
aaagggcgcaggaaactggaactggaggtcaggaagctgcgaggcctggttcaggacaaa
gagactaacctggctgagtcagacgatcgtcaaaggaagatccaggcggaagcagagcta
aggaaaataaaagctcgcattcttgaactggagaacactcccccacctgtggaggagaaa
atcatcatcgaggaggtcctgaaagtggagagagaccccaagctggaaaagctcacggac
gacgtacgcgccaacttggagactgagagcaccaaggtctctgacctggagagagaactc
aggaacctgcagctgaggctggaactgctgcaaaaagaaaaatcaatagaaaaagtcgtt
tacagagaagttgtacgtgtggagaaagacccgacagtggaagctgagagggatcgcctc
agagatttagtgtccaaggaaagaaaccacaggcgagacctggaagacaacgttcagagg
ataaccatccaaataaaccagctgagcacatcaaagtccatgaagtcccaggaggaggca
gctatcgcttctcagaaggaggcgctgcaaaaggagaaggaggatctcctcaaacagctg
aaagcgctggagtctcagagaagcagcattaacatcaccttccagcagcagtccaagctg
ttgagtgagaagaaccagcttgctcaccagagaagcctcaaaacctcctctgaagtcgaa
cgcctggagaaacagatcctgaatgagaaggacaaaattcaccagaaagagacccttatc
gctgagctgctgaaaagcatcaagaaagaagaacattcagaaattcacaccagggagacc
aacctctcaaccaagatcaccatcctggacccagaaaccggcaaagacatgtctccctac
aacgcgtacctgctgggtctaattgatcgagaccaataccttaagctgacagagctggag
tgcgactgggaggagatcacctcctctggtccagatggggacatctcaattctgcaggat
cgaaaaagtggtaagcagtactccatcaatgatgccctgaaagatggccgcttaactgag
actgactttaaacgcttcaaggacagaaagatgcccatttctgagtttgcactcatcgtg
gctggggagccacaaaagccttacatccctcccccacaggagagactcaacaaatctatc
cctgctactcaaacctctccattgaactccatgataccttccctgaggtcttcccaaacc
aacctgaactctcatctcaatggcagcttgaacgacctcagtgcagcagccgtggaggag
cacttcccaatctctggaatatttgacatgaccacggaaagccgcatgtctgtgagaagc
gccatgacacgcaagctcatagacgcagagaccggcctgaagctgctggaggcgcaggca
gcctccggcggcattgtcgacctcacaaaaaaggacaaactgtccgtgcacaaggcggtc
caaaaccacctcattgactctagccacatgcacaagctcctgaacgcccagaaggccttc
actggggttgaggatccagtttctaaagtacgtctctcaacatcacaggcagcgcagaaa
gggtatatcccccctgaaaatgccaagaggtacctggaggcgcagtacctgaccggtgga
ctagtcaatccctctaagccgggccgcctgaccatccaagaggccctcgctaccagaatg
attgacagcaaagcagcagaggagctgcaagatgaagccttccacacaaaggagctggtg
gaccccatcaccaaacagaatatctcttacaagcaggctatggaccggtgcaagaaggac
cccagcaccgggctactgctgcttcctgtagtctccactgacgctgaaaatactccatcg
tactccaactatcgcttccactccccgcacagcaaagtctag

DBGET integrated database retrieval system