KEGG   Oryzias latipes (Japanese medaka): 101155144
Entry
101155144         CDS       T02443                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101155144
   04370 VEGF signaling pathway
    101155144
   04068 FoxO signaling pathway
    101155144
   04070 Phosphatidylinositol signaling system
    101155144
   04150 mTOR signaling pathway
    101155144
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101155144
  09143 Cell growth and death
   04210 Apoptosis
    101155144
   04218 Cellular senescence
    101155144
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101155144
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101155144
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101155144
   04625 C-type lectin receptor signaling pathway
    101155144
  09152 Endocrine system
   04910 Insulin signaling pathway
    101155144
   04914 Progesterone-mediated oocyte maturation
    101155144
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101155144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101155144
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101155144
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act SH2_2 BRE1 Mod_r
Other DBs
NCBI-GeneID: 101155144
NCBI-ProteinID: XP_023820818
LinkDB
Position
17
AA seq 466 aa
MVYPSEGLFYIEMDQAPPALPPRSSKPVMSGMNNNCLSLPVHSLLDAEWYWGDITRDEVN
EKLRDTPDGSFLVRDASTKLQGDFTLTLRKDGHNKLIKIYHCDGKYGFSDPLTFTSVVEL
IWYYQHHSLVEYNATLDLMLTNPVSRFQQVKEDNVDVAGRKLKELHNQYQVKSKEFDQLY
EAFTKTSQEIQMKRTAIEAFNETMMIFEEQCREQERYGEEIERNSEGTDNDLESFLINYE
KLKCRLGEIYDSKIHLEEDLRIQVEDYRDTDRKINSLRPDLIQLRNIRDQYLNWLNHKGV
RQKRINDWLGIHNDSFDDTYVLKGDEKNLPHNDEASWFVGELSRTQAEEMLQDKAAGTFL
IRESSKQGCYACSVVVNQEVKHCKIYSTPHGYGFAEPYDIHCSLKDLVLHYRLHSLAQHN
DALDVRLSHPVNAKDATAAASQQTEENKLLQTPKHTSGLPPAAPEM
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggtttatccttccgaaggtttattctacatcgaaatggatcaagcgccaccagctctt
cctcccagatcaagtaaaccagtaatgtctggtatgaacaacaactgcctttctctacct
gtgcactcgctgctggatgctgagtggtactggggagacataactagagacgaggtgaat
gagaagcttcgggacacacctgacggctcttttttggtgcgtgacgcatccacaaagctg
caaggggactttacactgacattaaggaaagatggacacaacaagctgattaaaatttat
cactgtgacggcaagtacggcttctcggatccgctaaccttcacttcggtggtagagcta
atttggtactatcagcaccactctttggttgagtacaatgccaccctggacttgatgctc
accaaccctgtgtcccgtttccagcaggtgaaggaggacaatgtggatgttgctggtaga
aagctcaaggagcttcacaatcagtaccaagtgaaatcaaaggagttcgaccagctttat
gaagcctttacaaagacttcacaggagatccagatgaagcgcactgcaatagaggccttt
aatgaaacaatgatgatctttgaggagcagtgtcgtgagcaggagcgctacggagaggag
atagagaggaactcagaaggcactgacaatgatttggagagcttccttataaactacgag
aagctgaaatgtcgcctcggggagatttatgacagtaaaatccaccttgaagaagacttg
agaatacaagtggaggactatagagatacagacaggaagatcaacagcctgcggccagac
ctcatccaactgcgcaacatcagagaccaataccttaactggcttaatcacaaaggcgtg
cggcagaaacgcatcaatgactggttggggatacacaacgacagctttgatgatacgtac
gtgctgaaaggagatgagaagaacctgccacataatgatgaagcaagctggtttgttggc
gagttgagtcggacgcaggctgaggagatgcttcaagacaaagctgcaggaacattcctg
atccgcgagagcagcaagcagggatgttacgcctgctctgttgtcgtgaaccaagaggtg
aagcactgcaagatctacagcacgccgcacggatatggcttcgcagaaccctacgacatc
cattgctcgctcaaagacctcgtcctgcactatcgcctgcactccttagcgcaacacaac
gatgctctggatgtccggctgtcgcacccagtgaacgccaaagacgcaacagccgctgct
tctcaacaaacagaggaaaataaacttttacagactccaaaacacacgtcgggactccct
cccgccgctccagagatgtga

KEGG   Oryzias latipes (Japanese medaka): 101156504
Entry
101156504         CDS       T02443                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101156504
   04370 VEGF signaling pathway
    101156504
   04068 FoxO signaling pathway
    101156504
   04070 Phosphatidylinositol signaling system
    101156504
   04150 mTOR signaling pathway
    101156504
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101156504
  09143 Cell growth and death
   04210 Apoptosis
    101156504
   04218 Cellular senescence
    101156504
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101156504
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101156504
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101156504
   04625 C-type lectin receptor signaling pathway
    101156504
  09152 Endocrine system
   04910 Insulin signaling pathway
    101156504
   04914 Progesterone-mediated oocyte maturation
    101156504
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101156504
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101156504
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101156504
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 Laminin_I SH3_9 SH3_2 Lant_dehydr_C Exonuc_VII_L Mod_r GLTSCR1 PI_PP_I RNA_binding DUF4806 Bap31_Bap29_C BRE1
Other DBs
NCBI-GeneID: 101156504
NCBI-ProteinID: XP_023814615
LinkDB
Position
9
AA seq 717 aa
MSSEGFQYRALYDYKKEREEDIDLHVGDMLLVSKGALLALGCSNGAEERPSEIGWLPGFN
ETTQEKGDFPGTYVEFVGRKRISPPTPKPRPPRPPSAASTRTDSESESFVLPDLPEQFGP
PDTAPPLLSRLMEAVEARGLDSPGLYRSAAGGVLDTRQLADTDLEQLEVPSLCDGVIRFL
LDLPGPVLPPQLQGEMVHAVQEVRDPEDCAQVLRAVASSAACPAQYGLTLLSVVRHLARL
CLHATRNQLSPRMLGELFSPLLFRLAAGSESGPDPLVQVLEVLITSELNMNQAAPALPPK
PPKTPTPAASSSFNNSMALQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYT
LTLRKGGNNKLIKIFHREGKYGFSDPLTFSSVVELINHYRHESLAQYNPKLDVKLLYPVS
KHQQDQVVKEDSIEDVGKKLHEYHLQYQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNE
TIKIFEEQCQTQERFSKEYIEKFRREGNEKEIQRIMENYDKLKSRISDIVDSKRHLEADL
KKQAADYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQRKLNEWLGLKNETTEDEY
SMVEDEEDLPHHDERLWRLGNINRGQAEALLRGKRDGTFLVRDSSKPGCYACSVVVEGEV
KHCVINKTSTGFGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAFPVYSQQRR
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgagttcagagggctttcagtaccgcgcactgtacgactacaagaaggagcgggaggag
gacattgacctgcacgttggcgacatgctgctggtcagtaagggagcgctgctggcgctg
gggtgcagcaacggcgccgaggagaggccgtcggagatcggctggctcccgggcttcaac
gagaccacacaggaaaaaggcgacttcccagggacatacgtggagtttgttggaaggaaa
agaatttccccgcccacccccaagccccgcccaccccgaccgccatctgctgcctcaacg
aggacggactccgagtcggagagttttgtgttgccagatctgccggaacagtttggacct
ccagacacggcgccgccgctcctcagcagactgatggaggccgtcgaggcgagaggtctg
gacagtcctggtctgtatcgcagcgccgccggaggagttctggacacgcggcagctggcc
gacacggacctggagcagctggaggtgccgtccctttgtgacggggtgatccggttcttg
ttggatctgcccggtcccgtgctgcccccccaactgcaaggtgaaatggtccacgcggtc
caggaggtccgagacccggaggactgcgctcaggtgctgcgggccgtggccagctcggcc
gcctgccccgcccagtacggtctgaccctgctcagcgtggtccggcacctggcccgcctg
tgtctgcacgccaccagaaaccagctgagcccccggatgctgggggagctcttcagcccg
ctgctgttcagactcgccgcagggtccgagtccggtccggatcctctggttcaggtgctg
gaggttctgatcaccagcgagctcaacatgaaccaagctgctccagctctgcctcccaaa
cccccgaagacgccgacccccgcagcttccagcagcttcaacaacagcatggctctgcag
gacgccgagtggtactggggagacatctccagggaggaggtcaacgagaagctgagggac
acggctgacggtacctttctggtccgagacgcctccacaaagatgcacggggattacacg
ctgaccctgaggaaaggcggcaacaacaaactgataaagatcttccaccgtgaggggaag
tacggcttctccgacccgctgaccttcagctcggtggtggagctgatcaatcattacaga
cacgagtctctggctcagtacaaccccaagctggacgtcaagctgctgtacccggtctcc
aaacaccagcaggaccaagtggtgaaggaggacagcatcgaagacgtggggaagaagctg
cacgagtaccacctgcagtaccaggagaagaaccgcgagtacgaccggctgtacgaggag
tacaccagaacctcccaggagatccagatgaagaggacggccatcgaggcgttcaacgag
accatcaagatcttcgaggagcagtgtcagacgcaggagcgcttcagcaaagagtacatc
gagaagtttagacgggagggcaacgagaaggagatccagaggatcatggagaactacgac
aagctgaagtcccggatcagcgacatcgtggacagcaaacgccacctggaggcggatctg
aagaaacaggccgccgactaccgagagatcgacaagaagatgaacagtatcaaacccgac
ctgatccagctccgcaagacccgggaccagtacctcatgtggctgacgcagaagggcgtc
cggcagaggaagctgaacgagtggctgggcctgaagaacgaaaccaccgaggacgagtac
agcatggtggaggacgaggaggaccttcctcatcacgacgagcgtctgtggcgtctgggg
aacatcaaccgcggtcaggcggaagctctgctgcgcggcaagagagacggcaccttcctg
gtccgggacagcagcaagcctggctgctacgcctgctccgtggtggtggagggggaggtg
aagcactgcgtcatcaacaagacgagcaccggcttcggcttcgccgagccctacaacctg
tacggctccctgaaggagctggtcctgcactaccagcacacctcgctggtccagcacaac
gactcgctcaacgtcacgctggccttccccgtctacagccagcagaggcggtga

KEGG   Oryzias latipes (Japanese medaka): 101161626
Entry
101161626         CDS       T02443                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101161626 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101161626 (pik3ca)
   04370 VEGF signaling pathway
    101161626 (pik3ca)
   04068 FoxO signaling pathway
    101161626 (pik3ca)
   04070 Phosphatidylinositol signaling system
    101161626 (pik3ca)
   04150 mTOR signaling pathway
    101161626 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101161626 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    101161626 (pik3ca)
   04218 Cellular senescence
    101161626 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101161626 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101161626 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101161626 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    101161626 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101161626 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    101161626 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101161626 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101161626 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101161626 (pik3ca)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101161626 (pik3ca)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101161626 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 101161626
NCBI-ProteinID: XP_011472487
UniProt: H2LYJ3
LinkDB
Position
4
AA seq 1068 aa
MPPRPSSGELWGLHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETCYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDFEVQDFRRNILNVCKDAVELRDANGPHSRALYVYPPNVESSQDLPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLGRLPNLMLMAKDSLYSQLPTD
SFVMPSYCRRISTATSYMNGEAAPKSLWTISGGLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLNYDMYILDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYNHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFEHF
SSPVKYPDMNAVEEHANWTISRELGFNYNTSGQSNRVARDHALTDSDSEQLKQLSNRDPL
SEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDEVAQMYCLLKEWPSIRPEQAME
LLDCNYPDPMVRHFAVRCLDKFLADDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMRFLVEQMKRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLW
LNWENPDIMSEMLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLS
LGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNRGEMYDMAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGSQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALEKGEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgccacccaggccatcttcaggggagctgtggggcctccacttgatgccccccaggatc
ctggtggactgccttctgcccaatgggatgattctgaccctggagtgtctccgtgaggcc
acacttatcaccatcaagcacgagctgttcaaggaggccagaaaatatccactccatcac
ctcttacaggaggagacttgctatatctttgttagtgtgacacaggaggcagagcgggag
gaattctacgatgagacccgcaggttgtgtgacctccgactcttccagccgttcctcaaa
gtcattgaaccagttggcaacagagaagagaaaatactcaatagggagattgggtttgcc
atcggtatgcctgtttgtgagtttgatcttgtaaaggatttcgaagttcaggactttaga
agaaacatcctcaatgtatgtaaagatgctgtggagctgagagacgccaacggcccccac
agcagagcgctatacgtttacccacccaatgtggagtcatcacaggatcttcccaaacac
atctatagcaaacttgacaaaggtcagataattgttgtgatatgggtgatcgtatcccca
aacaatgacaaacaaaagtatacattgaagatcaaccacgattgtgtgcctgaacaggtg
attgcggaggccattcgtaagaagacgcgcagcatgctgctgtctccagagcagctaaag
atgtgcgtccaagaatatcagggaaaatacatcctcaaagtctgcggctgtgatgagtac
ctgctggaaaagtaccccatcagtcagtataagtatatccgtagttgcatcatgttgggc
aggttgcccaatctgatgctaatggctaaagacagcctgtacagccaattgcctacagac
agcttcgtcatgccgtcatactgtcgacgcatctccacggcaacgtcgtatatgaacggc
gaggctgctccaaagtcgctgtggaccatcagcggaggtctcaggataagaatcctttgt
gccacctacgtaaatgtaaatatacgggacatagacaagatatatgtgaggacggggatt
tatcatggaggtgaacaaatgtgtgataatgtcaacacacagagagtaccatgctccaat
cccaggtggaatgagtggctcaactatgacatgtacatcctagacatccctcgagcagcg
cgactctgtctctccatctgctctgtgaagggcaggaagggagctaaagaggagcactgt
cctttggcctggggcaacatcaacctgtttgattacaatcacactctggtggcaaataaa
atggccctgaacctctggcctgtccctcatggactggaagaccttctcaatcccattggg
gttacaggatccaaccccaacaaggaaacgccatgtctggagctggagtttgagcacttc
agcagtccggtaaaatatccagatatgaatgcggtggaggagcatgcaaactggaccatc
tccagggaactggggtttaactacaacacctcaggacagagtaatcgtgtggccagagat
cacgccctgacagacagtgactctgaacaactgaagcagctgagtaacagggaccctctg
tcagaaataactgagcaggagaaagacttcctctggagacacaggcactattgcatgaac
atccctgagatccttcccaagatccttcttgctgtcaaatggaactccagagatgaagta
gcacagatgtactgtttgctgaaagagtggccatctatccgtcctgagcaggccatggag
ctgttggattgtaactacccagaccccatggtcaggcactttgctgtacgctgccttgac
aaattcctggcggatgataaactgtcccagtacctcatccagcttgtacaggttttgaaa
tacgagcagtatcttgacaatccactggcccgcttcctcctcaaaaaagctctgaccaat
cagaggatagggcatttcttcttttggcatctcaagtcagaaatgcacaataaaactgtg
agccagcggtttgggctgctgttggaggcttactgcagggcttgtgggatgtacctcaag
cacttgagccggcaggtagaagcaatggagaaactcatcaacctcactgatattctcaag
caagaaaagaaggatgagacacaaaaggtccaaatgcggtttcttgtggagcagatgaag
agacccgactacatggatgccctgcagaacttcacctctcctctcaaccctgcacaccaa
ctgggaaacctgaggttagaggactgcaggattatgtcatctgcaaagaggccgctgtgg
ctgaactgggagaacccggacatcatgtcagagatgctttttcagaacaacgagatcatt
ttcaaaaatggagatgacttgcgtcaggatatgctgacattgcagatcattaaaataatg
gagaacatttggcagaatcagggactggatctgcggatgctgccctatggctgtctgtcg
ttaggagactgcgtggggctcatcgaggtggtccgtagttcccacaccatcatgcagatt
cagtgtaaaggaggcttgaagggagccttacagttcaactccaacactctgcatcagtgg
ctcaaggacaaaaacaggggagagatgtatgacatggctgtggatctgttcaccaggtcc
tgtgctggctactgtgtagctacattcatcctggggattggagatcgccacaacagcaac
attatggttaaagatgacggacagctgtttcatatagatttcgggcatttcctggatcat
aagaagaagaaatttggctacaaaagagaacgggtacctttcgtgctgacgcaggacttc
ctcattgtcatcagtaaaggatcacaggaatgcacaaaaaccaaagagttcgaaaggttc
caggagatgtgctacaaagcttacctagccatccgccaacatgccaacctcttcatcaac
ctgttctccatgatgctgggctccgggatgcctgagctgcagtcctttgacgacatcgcg
tacatccgaaaaacgctggcgctcgagaaaggcgagcaggaagcattggactactttatg
aaacagatgaacgatgctcaccatggagggtggaccaccaagatggactggatattccac
acaattagacagcatgcactcaactga

KEGG   Oryzias latipes (Japanese medaka): 101161887
Entry
101161887         CDS       T02443                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101161887 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101161887 (pik3cd)
   04370 VEGF signaling pathway
    101161887 (pik3cd)
   04068 FoxO signaling pathway
    101161887 (pik3cd)
   04070 Phosphatidylinositol signaling system
    101161887 (pik3cd)
   04150 mTOR signaling pathway
    101161887 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101161887 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    101161887 (pik3cd)
   04218 Cellular senescence
    101161887 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101161887 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101161887 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101161887 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    101161887 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101161887 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    101161887 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101161887 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101161887 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101161887 (pik3cd)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101161887 (pik3cd)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101161887 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4037 DUF4135
Other DBs
NCBI-GeneID: 101161887
NCBI-ProteinID: XP_004070711
UniProt: A0A3B3IIX4
LinkDB
Position
7
AA seq 1039 aa
MHPGIYGMLEEWEDGDQEINMDFLLPTGIFLKFPVSRNDTIKHIKEMVWRNARSEALFSG
LGDPDGYVFTCINQTAEREELEEEFRRIRDVKPFMCVLRLVAREGNRQEKLTNTQITQLI
GKGLHEFETQKNHEVNEFRTKMRTFCEEKALERQYLPWQRWLEYSFPCDLEPCRTPSGFG
SVKMKSSKIFINVKFEASDESFMLQQDCHDLPVALMKSALKKKATVFRSLRQEPEDYILQ
VNGRWDFIYGKHPLCQFKYIFSCLRNGQNPQLTMVHHSTVSRFQEEQSRMCNQMFKSRSL
SRPPPLPLKRQNTSSLWSINEPFYIQLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVTS
LDVTVCSEPLWDQRLEFDINVCDLPRMSRLCFALYAVIEKTKKPKSTKKKNKKADCPIAW
VNTMVFDYKDQLKTGEFLLSMWPSVPDDKSDLLNPMGTVEKNPNVDSAAGLLIRFPNIRP
HPLYYPSLEKIIDFEKNGDVACTHKEEHLKLKEIMDNKHYTEFFEDEKDLLWKLRTEIRE
HYPENLSKLLLVTKWNKREDVVQMVSLLKKWPDLPAIHALELLDYSFPDPAVRSFTVRCL
RKLSDDELLQYLIQLVQVLKYESYLDCDLTTFLLERALSNRRIGHFLFWHLRSEIHVASV
SLRFGLILEAYCRGNIHHIKILNKQNEALAKMRALSDFVKSGSQKMTVEDLKLCIRQETY
MEALSDLLSPLNPSIILTEICADKCRFMDSKMKPLWLMYKNPSTPGDMVGIIFKNGDDLR
QDMLTLQMIQLMENMWKKEGLDLRMIPYGCLSTGNKMGLIEVVKNSDTIANIQLNSSNSA
ATAAFNKDALLNWLKSKNPGDKLEQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRETG
QLFHIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCEQAYK
ILCRNGMLFVNLFAMMKAAGLPELTCFKDIQYLKDSLALGKSEDEALKNFKVKFNEALRE
SWKTKVNWMMHSLAKDNRA
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgcaccctgggatatatgggatgctggaggagtgggaggatggggaccaggagatcaac
atggacttcctgctgccaactgggatcttcctcaaattccctgtgtctcgcaatgacact
atcaaacacatcaaagagatggtttggcgaaatgccagaagcgaggctctgttcagtgga
ctgggtgacccggacgggtatgtgttcacctgcattaaccagacggccgagagggaggag
ctagaggaggagttccggcggataagggatgtgaagcctttcatgtgtgttctgaggctg
gtggcaagggagggtaacagacaagaaaaactcaccaacacccagatcacccagctcatt
ggcaaaggtctgcatgagtttgagacccagaagaaccacgaggtcaatgagtttcgaaca
aagatgaggacgttttgtgaagaaaaagctctggagaggcaatatttaccatggcaacga
tggcttgagtacagcttcccatgtgacctggagccatgccgcacgccgtctgggtttggg
agtgtgaagatgaaaagctcaaagattttcatcaatgtcaagtttgaggcttctgatgaa
agcttcatgttgcagcaggactgtcatgaccttcccgtggcgctgatgaagagcgctctg
aagaagaaggccaccgtctttcgctcgctgaggcaggagcctgaggactatatcctacag
gtcaacgggagatgggacttcatctatgggaaacacccactctgccagtttaaatacatc
ttctcgtgcttgagaaatggtcagaacccccagctcaccatggtgcaccactccaccgtc
agcaggttccaggaggagcagagcagaatgtgcaaccagatgtttaagagtcgctccctg
tccagacctcctcctctgcccctgaagaggcaaaatacctcctctttgtggtccattaat
gagcccttctacattcagctgctgcagggcagccgcgtcaatgcagacgaaggcatgaag
cttgtggtgcaggccggcctgttccacggcagcgagctgctctgcaaggtggtgacgagc
ttggatgtgacggtgtgctcggagccgctgtgggaccaaaggctggagtttgacataaat
gtgtgcgacctgccccgcatgagccgcttgtgcttcgcgctctacgctgtcattgagaaa
accaagaaacccaaaagcaccaaaaagaagaataaaaaagcggactgtccaatagcgtgg
gttaataccatggtgtttgactacaaggaccagttaaagacaggggaatttctcctatct
atgtggccatctgtacctgatgacaaaagcgatctgttgaacccgatggggacagtggag
aagaaccccaacgtggacagcgctgctggtcttctcattcggttccccaacattcgtccc
catcctctctattatccatcactcgaaaagataattgactttgagaagaatggagacgtg
gcgtgtacccataaggaagagcacctgaaacttaaagaaatcatggacaacaaacattac
acagagtttttcgaggatgagaaagatcttctgtggaagctccgcacagaaatccgcgag
cactatccggaaaatctgtccaagctgctcctcgtcactaaatggaacaaaagggaggat
gttgttcagatggtgagtttactgaagaaatggcctgaccttcctgccattcatgccctg
gaactcttggactacagttttcccgacccagctgtccgctccttcactgtccgctgcctg
aggaagctcagtgatgatgagctgctgcagtacctcatccagctggtccaggtcctgaag
tatgagtcctacctggactgtgacctcaccaccttcctgctagagagggccttatcgaat
aggagaataggacactttctcttctggcatcttaggtcagaaattcacgtggcatctgta
agtttgcgctttggccttattttggaagcatactgccggggaaacatccaccacatcaag
attttaaacaaacagaatgaagctctggccaaaatgagggccctgagcgactttgtcaag
tcaggctcccagaaaatgaccgtagaggacttgaagctgtgcatcagacaggaaacctac
atggaggccctgtcagacttgctgtcgccgctcaaccccagcatcatcctcacagagatc
tgtgcagacaagtgcagatttatggactcaaagatgaaacctctctggctgatgtacaag
aacccctcaaccccaggagacatggtgggcatcattttcaaaaacggcgatgatcttcgg
caagacatgttgactttgcagatgattcagctcatggagaatatgtggaagaaagaaggc
ctggatctcaggatgatcccatacggctgcttgtccacggggaacaaaatgggactcatt
gaagtcgtgaaaaactctgacaccattgcaaacattcagctcaacagcagtaacagtgca
gccacagccgccttcaacaaggatgccctgctcaattggcttaaatctaagaatcctggt
gacaagcttgaacaagcaatagaggagtttacattgtcctgtgctggctactgtgtagct
acatatgtgttgggaattggagatcgccacaatgacaacatcatgatcagagaaactgga
cagctgtttcacatcgactttggccatttcctgggcaacttcaagcgtaaacttgggatc
aaccgagagcgggttcctttcatcctgacatatgactttgtgcatgtgatccaacaagga
aggacgaacaacagtgagaagtttgagagatttagggagtactgtgagcaggcctacaag
atcttgtgcagaaatgggatgctgttcgtcaacctcttcgccatgatgaaggctgcaggg
ctgcctgagctcacctgcttcaaagacattcagtatctaaaggactccttagctttgggc
aaatccgaggatgaagcactgaagaacttcaaagtaaagtttaacgaagctttgcgagag
agctggaagacgaaggtcaactggatgatgcactccttagccaaagataacagagcataa

KEGG   Oryzias latipes (Japanese medaka): 101163728
Entry
101163728         CDS       T02443                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101163728
   04370 VEGF signaling pathway
    101163728
   04068 FoxO signaling pathway
    101163728
   04070 Phosphatidylinositol signaling system
    101163728
   04150 mTOR signaling pathway
    101163728
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101163728
  09143 Cell growth and death
   04210 Apoptosis
    101163728
   04218 Cellular senescence
    101163728
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101163728
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101163728
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101163728
   04625 C-type lectin receptor signaling pathway
    101163728
  09152 Endocrine system
   04910 Insulin signaling pathway
    101163728
   04914 Progesterone-mediated oocyte maturation
    101163728
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101163728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101163728
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101163728
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 FadA IL22 DUF948 ATG11 DUF4407 LMBR1 GCN5L1
Other DBs
NCBI-GeneID: 101163728
NCBI-ProteinID: XP_023810012
LinkDB
Position
4
AA seq 549 aa
MAAKSFHLWTEDELKPNDVLTSSLASLRLTDEAVVTSENTVHMVDNPKPDPTFPEMTSSL
LHQSRQQSDISIATKPEPLPADQESLEKEKGHSSSEVQSCTPRVFLQDLSSHTDGDDKAF
LALKISSKEKVWSESDTTKPMAAYESNADNLQLSEAEWYWGNISREEVNNLMRNTPDGTF
LVRDSSSGIKGEYTLTLRKDGYNRLIKIFHYGEKCGFSEPLVFPSVVDLIQHYQKKSLAQ
YNSKLDTRLLYPVSRFQEQHLVMEVDIDAAGEQLRIYQDQYKETSKEYDQLFKELNQTSQ
ELQSKRTAIEAFTEIIRIFEEECETQERYSKEYIDMFLALDSSSNTEKIQSNPEELQSRV
EEIHSSKKKLEEELKKKALAHMEVDRKMNGLKPDLVQLRKIRDQYLLWLTQQGTSQSQIN
EWLGIKREEEDLYTLEDDTHQERSWYVGGMRRKEAEELLRGRRDGTFLIRESQTQRGSFA
CSVVVDGEVKHCVIYRTATGYGFAEPYNLYSSLRELVLHYRHTSLIQHNQQLNVTLAWPA
LSQPFSEET
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggccgccaagagtttccacctctggaccgaggacgagctgaagccaaacgatgtcctg
acatcctctctagcatctctccggctaacagatgaggctgtggtcacgagcgagaacaca
gtccacatggtggataatcccaagcccgatcctacatttcctgagatgacatcatcactg
cttcaccaatcacggcagcagtcagacataagcatagctactaagcctgagcctctacca
gcagatcaagagtccttggagaaggagaaaggccacagcagcagtgaggtgcagtcttgc
acaccgagagttttccttcaggacctctcctcacacactgatggagatgataaagcattt
cttgccctaaaaatcagcagcaaggaaaaagtttggtcagagagtgatacaaccaaacca
atggcagcctatgagagcaatgcagacaacctccagctatctgaagcagagtggtactgg
ggaaacatctcaagagaggaagtaaataacttgatgagaaacactcccgatgggactttt
ctggttcgagactcctccagtggaattaaaggagaatacactctgaccttacggaaggat
ggctataacaggttgataaaaatcttccattatggggaaaagtgtggcttttctgagcca
cttgtcttcccctctgtggtggatctgatccagcattatcagaagaaatcgctagcacag
tacaactctaaactggatacacggttactctacccagtatccagatttcaggagcagcac
cttgtaatggaagttgacatagatgcagccggtgaacagttgagaatatatcaggatcaa
tacaaagagacgagcaaagagtatgatcagttgttcaaagagctgaaccaaacctcccag
gaacttcaaagtaagaggacagccattgaggcttttactgaaataatcaggattttcgaa
gaggaatgtgaaactcaagaacgctacagcaaggaatacattgacatgttccttgcatta
gatagcagctcaaatacagaaaagattcaaagcaaccctgaagagttgcagtcaagggtg
gaggagattcacagcagcaagaagaagttggaagaagagttgaagaagaaagctctggct
cacatggaagttgacaggaaaatgaatggcttgaagcctgaccttgtgcaactcaggaaa
atcagggatcaatacctactgtggctcacccagcaaggtactagtcagagccagattaac
gagtggttgggtataaagagagaagaagaagatctctacaccctggaggatgatactcac
caggagaggagctggtatgtgggtggcatgagacgaaaagaggcggaggagctgctgaga
gggaggagagatggaactttcttaatcagagagagtcagactcagaggggctccttcgcc
tgctctgttgttgtggacggagaggtgaaacactgtgtcatctacaggacggctacaggg
tatggctttgcagagccctacaacttgtactcatcgctcagggagcttgttctccactac
agacacacatccttgatccaacacaaccagcagctgaatgtaacccttgcctggcctgct
cttagtcagccattcagtgaagaaacatga

KEGG   Oryzias latipes (Japanese medaka): 101165660
Entry
101165660         CDS       T02443                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101165660 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101165660 (pik3cb)
   04370 VEGF signaling pathway
    101165660 (pik3cb)
   04068 FoxO signaling pathway
    101165660 (pik3cb)
   04070 Phosphatidylinositol signaling system
    101165660 (pik3cb)
   04150 mTOR signaling pathway
    101165660 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101165660 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    101165660 (pik3cb)
   04218 Cellular senescence
    101165660 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101165660 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101165660 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101165660 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    101165660 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101165660 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    101165660 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101165660 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101165660 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101165660 (pik3cb)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101165660 (pik3cb)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101165660 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Other DBs
NCBI-GeneID: 101165660
NCBI-ProteinID: XP_011481352
UniProt: A0A3B3HRG4
LinkDB
Position
13
AA seq 1078 aa
MPPAMTDLVDIWAAHSPLDGQAPVHVTMDFLLPTGIYIQMEVPREATIQHIKLLLWKQAK
SFPLSSFLGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVFRLVTRNCGRAERLLD
SKIGVIIGKGLHELDGINDQEVKDFRSKMQRLSEERMQRVQMMSFTEWLQACFSPQLEPS
AGTAIADGANDWPADLKVIIHFDQSQDSTSLKVPSSCTPSVLIEIALKKWQTTHAPEEET
NKDKHILRVSQCLDFLCGDHPLIQYKYIRSCLQAKESPHLTLVHINAVKTIFDKENAAIG
AVVSRKSSNPPLPLPPKKRAPTQVQTCVWDVSRPFKVVLVKGSTVNADENAKVQVRAGLF
HGTELLCKPAVSSESSGRSNHSLENNTLEFEISVCDLPRMTRLCFAIYAIMEKVKKKSYK
NPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDMILHCWSSFPDELEEMLNPIGT
VRINPYPENATALHIHFPDYGPHPIVFPPFDKILEKAAEIAGSSDSTPIGRGGKKFHIEL
KEIMERDPLSQLCENEKDLIWTLRLDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQIW
PKLSPRDALELLDFNYPDQYVREYAVSCLRDMSDEELLQYLLQLVQVLRYEPYYDCALTH
FLLERAQKNRKIGHFLFWHLRSEIHMPAVSIQFALILEAYCRGSIPHIEVLKKQVEALSK
LKSVNELIKLGTIKNTRSKTKEAMLTKEAMITCLKQSGYSEALSDLHSPLNPNVLLSDIN
VEKCRYMDSKMKPLWIVYNNKLMSSDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEANL
DLRIVPYGCLATGDRAGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKERNSGD
ALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIK
RERVPFILTHDFIHVIQQGKTGYTEKFGSFRQYCEEAYLVLRKNGNLFITLFALMLTAGL
PELTSVKDIQYLKDSLALGKSDEEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgcctcctgctatgaccgaccttgtggacatatgggcagcccactcgccgctggatgga
caggcgccagtccatgtcaccatggactttctgctgcccactggaatctacatccaaatg
gaggtcccacgagaggccacgattcaacatatcaaactactcttatggaagcaggccaag
tcattccctctatcttcattcctcggcgaaatggagagccacatgttcgagtgtgtcaac
caggcagccgtacatgaagagctggaggacgaaacccgccgactatgtgacgttcggcct
tttctgccggtctttaggctggtgactcgcaactgcgggcgagcagagcgcctgctggat
tccaaaattggagtaatcattggaaagggtctccacgaactagatggcatcaatgaccag
gaagtgaaagactttcgcagtaaaatgcagcgtctgagtgaggagaggatgcagcgtgtg
cagatgatgtccttcacggagtggctgcaggcctgcttttccccacagctggagcccagt
gccgggacggccatcgcagacggagccaacgactggcctgcagacctgaaagtcattatt
cactttgaccagtcccaggattccaccagtctgaaggtcccgtcatcttgcaccccgtcc
gtgttgatcgagatcgctttgaaaaagtggcagaccactcatgcacccgaagaagagacg
aacaaagacaagcacatcctgagagttagccagtgcctggacttcctctgtggagaccac
cccttaatccaatataagtacatccgctcatgccttcaagccaaggagtccccccacctc
accctggtccacatcaacgcagtgaagaccatattcgacaaggaaaacgccgccattggg
gcagtggtcagccgcaagtcctccaaccctcctttacctttgcctcccaagaaacgggct
cccacgcaagtccagacgtgtgtgtgggatgtgtcgagaccatttaaggtagtactcgta
aaaggcagcacagtgaatgcagatgaaaacgccaaggtccaggtgagggcgggtcttttt
cacgggacagaactgctctgtaagcccgccgtgagcagcgagagcagcgggcgctccaat
cactccttggagaacaacacgctggagtttgagatctcggtctgcgacctcccgcgcatg
actcgcctctgctttgctatttatgccattatggagaaggtcaaaaagaagtcctacaaa
aaccctcacattaacaagtaccaaaccatccgcaaggcaggaaaggtgcactaccccatt
gcttgggtcaacactatggtgtttgactacaaagggcagctgaagactggagacatgatc
ctgcattgctggtcttcctttcctgatgaacttgaagagatgctgaacccaataggaact
gttcggatcaacccgtaccctgagaatgccacagcgctgcacatccacttcccagattat
ggaccacatcccatcgtctttcctccttttgacaagatactggagaaggcagcagagatt
gctggatcgagtgacagcacacccataggtcgtggaggtaagaagttccacatagaactg
aaggagatcatggagcgcgacccactctcccagctgtgtgagaacgagaaggatttaatc
tggacactacgcttagactgtcgggagaattttccacagtctcttccgaagctgctgctc
tctgtgaaatggagcaaacacgaggacatggcccagctgcaggcacttcttcagatctgg
cccaagctgagtcccagagatgctctggagcttctcgacttcaactaccctgatcagtat
gtcagagaatatgccgtcagctgcctccgggatatgagtgatgaggaactgttgcagtac
ctgctgcagttggtgcaagtgttgcgttatgagccctactacgactgcgccctcacccat
ttcctgcttgaacgcgcccaaaagaatcgcaaaataggacattttctcttttggcactta
aggtcagagatccacatgcctgcagtctccatccagtttgccctcatcctagaagcatat
tgtagaggcagcattcctcatattgaggttctaaagaaacaggtggaggctttgagtaaa
ctaaagtccgtcaatgagctcattaagctgggaacaattaagaacactcgtagcaaaacc
aaggaggccatgctgaccaaggaagccatgatcacatgtctaaaacagagtggctactcg
gaggctctgtcggacctgcactcccccctgaaccccaacgtcctgctgtcagacatcaac
gtggaaaagtgccgctacatggactccaagatgaagcccctttggattgtttacaacaac
aagctgatgagcagcgacactctgggaatcatcttcaaaaacggagatgatctgagacaa
gacatgctgaccttgcagattctgaggttgatggatcttctgtggaaggaggccaacctg
gacctcagaattgtgccgtatggttgcctagcaacaggcgatcgggctgggttgatagag
gtggtctcgtcagcagacacaattgcaaacattcagctgaccagcagcaatgtcgcagca
gctgcagcattcaacaaggacgccctgcttaactggctcaaagagaggaattctggagat
gctctggagcgagccatcgaggagttcactctgtcgtgtgcaggctactgtgtagccacc
tacgtcctgggcatcggagaccgccacagtgacaacatcatggtccgcagcaccggacag
ctcttccacattgactttggtcacattctgggaaatttcaagtccaagtttggaatcaag
agggagcgagtgccatttatcctcacgcacgacttcatccacgtcattcagcagggcaag
accggatacactgaaaagtttggcagtttccggcaatactgtgaagaggcttatctggtc
ctgaggaagaatggcaacctcttcatcacactgtttgccctcatgctgactgctggctta
cctgaactcacctcagtcaaagacatccaatacctaaaggactcactggccttggggaag
tctgatgaagaggccctcaagcagttccgccaaaagtttgatgaagccttgagggagagc
tggacgaccaaggtgaactggatggcccacaacgtcgccaaggacaaccgctcctag

KEGG   Oryzias latipes (Japanese medaka): 101168152
Entry
101168152         CDS       T02443                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101168152
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101168152
   04370 VEGF signaling pathway
    101168152
   04068 FoxO signaling pathway
    101168152
   04070 Phosphatidylinositol signaling system
    101168152
   04150 mTOR signaling pathway
    101168152
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101168152
  09143 Cell growth and death
   04210 Apoptosis
    101168152
   04218 Cellular senescence
    101168152
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101168152
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101168152
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101168152
   04625 C-type lectin receptor signaling pathway
    101168152
  09152 Endocrine system
   04910 Insulin signaling pathway
    101168152
   04914 Progesterone-mediated oocyte maturation
    101168152
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101168152
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101168152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101168152
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101168152
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101168152
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15 Lipoprotein_Ltp DUF5314
Other DBs
NCBI-GeneID: 101168152
NCBI-ProteinID: XP_004078950
UniProt: A0A3P9KTS6 H2LYJ4
LinkDB
Position
17
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSIVVDCLLPNGMILSLECLREATLVTVKHELFKEARKYPLYH
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILSREIGFA
IGMPICEFDLVKDPEVQDFRRNILNVCKEAVDLRDNNGPHSRALYVYPPNVESSTDLPRH
IYNKLDKGQIIVVIWVIISPSNDKQKYTLKISHDCVPEQVIAEAIRKKTRSMLLSQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPSD
NFTMPSYARRISTATSYMNGETSSKNLWTINGMLKIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTLRVPCSNPRWNEWLSYDMYILEIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFEQF
SSPVKFPDMAYVEEHANWNISRELGFNYSHTGLSNRLARDNPLTDNDNEQLRQVCNRDPL
SEITEQEKDFLWRHRHSCINIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWIKDKNKGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKEDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccagaccctcctcaggagaattatgggggatgcacttgatgccccccagcatt
gtggtggactgccttttgcccaatggcatgattctgtcactggagtgcctcagagaagcc
acgctcgtcaccgtcaagcacgagctcttcaaggaggccaggaagtacccgctttaccat
ttgctccaagaagaaagctcctacatcttcgtcagcgtcacccaagaggcggagagggag
gagttttacgacgagaccaggaggttatgtgatcttaggctcttccaggccttcctcaaa
gttattgagccagtgggcaacagagaggagaaaattctcagcagggaaataggttttgct
attggaatgcctatctgtgagtttgatttggtaaaagacccggaagtacaggacttcaga
aggaacattttaaacgtttgcaaagaagcggtggacctcagagacaataacggcccacat
agcagagctttgtacgtctaccccccaaacgtagaatcctcgacagaccttcccaggcac
atctataataagctagataaaggtcaaatcattgttgtcatctgggtgattatttcaccc
agcaacgacaaacagaagtacaccttgaagatcagccacgactgtgtgccggagcaggtg
atcgccgaagccatccgtaagaagacgcggagcatgctgctgtcacaggaacagctgaag
atgtgcgtccaggagtatcagggaaagtacatcctcaaagtctgtggctgtgacgagtac
ctgctggagaaatatcctctgagtcagtacaagtacgtgcgcagttgtatcatgctggga
aggatgcccaacctgatgctgatgtccaaagacagcctgtactcccagctgccctcagac
aacttcaccatgccgtcgtacgcaaggcgcatctcgacggcaacgtcctacatgaacggg
gaaacctcttctaagaatctttggaccatcaacggaatgctgaagatccggatactctgc
gccacctacgtcaatgtaaacatcagagatatcgacaagatctatgtcaggactggaata
taccacggtggggagcagttgtgtgacaacgtcaacaccctgcgtgtgccctgctcaaac
ccaaggtggaacgagtggctgagctacgacatgtacattctagaaatccccagagctgct
cgactctgcctctctatctgctctgtgaaaggaaggaagggcgccaaagaggaacattgt
cccttagcctggggcaacatcaacctgtttgactacacccacacgctggtagcagggaaa
atggctctcaacctgtggcctgtcccacatggcctggaggacctgctcaaccccatcggc
gtcacaggctccaaccccaacaaggaaaccccgtgtctggagctggagtttgaacagttc
agctctcccgtcaagtttccagatatggcgtacgtggaggagcacgccaactggaatata
tccagagagctgggtttcaattacagccacaccggcttgagtaacagattggcgcgcgac
aaccccctgaccgacaacgacaacgagcagctccggcaagtgtgcaacagagacccgctg
tcagaaatcactgagcaggagaaggacttcctgtggaggcacaggcattcctgcatcaat
atacccgagatccttcccaaaatcctcctggctgtgaagtggaactccagggatgaagtt
gctcagatgtattgccttctgaaagactggcctgcaataaagccagaacaagccatggag
ctgctggattgcaacttcccagatcctatgatcagagagtttgccgtcaagtgccttgag
aaatacctgactgatgataaactctctcagtatcttattcagctggttcaggttttaaaa
tatgagcagtaccttgataacccacttgcacgtttcctgttgaaaaaggctttaaccaat
caaaggataggacatttcttcttctggcatttaaaatcagagatgcacaacaagacggtg
agccagcggttcggcctgctgctggagtcctactgccgggcctgtggcatgtacctgaag
cacctgagccggcaggtggaggccatggagaagctaatcaatctcaccgacctcctcaaa
caggagaaaaaagatgaggcgcagaaggttcaaatgaagtttctggttgagcagatgagg
aggcccgactacatggatgcactacaaagcttcacctcacctctcaatccagcacatcag
ctgggaaacctgcgcctggaagagtgcaggatgatgtcttcggcaaagcggcctctctgg
ttgaactgggaaaacccggacatgatgtcagaactgctttttcagaacaacgagatcatt
ttcaaaaatggagacgatctgaggcaggacatgctgacgctgcagatcattaggataatg
gagaacatctggcaaaaccagggccttgatctcaggatgcttccgtacggctgcctgtcc
atcggggactgcgtgggtttaatcgaggtggtgaggaactctcacaccatcatgcaaatc
cagtgcaagggaggtctaaagggggcgctgcagttcaacagccacacactgcaccagtgg
atcaaagataagaacaagggagagatgtacgaccaggctattgatctcttcacgcggtcc
tgtgcaggctactgtgtggccaccttcatcctcggtataggagacagacacaacagcaat
atcatggtcaaagaagatggacagctgtttcacatcgactttggtcatttcctggaccac
aaaaagaagaagtttggctacaagagagagcgcgtcccgtttgtgctcacacaggacttc
ttgattgtcatcagcaaaggaacccaggagtgcaccaaaaccagggagtttgaaaggttt
caggaaatgtgttacaaagcttacttggccatccgccagcacgccaacctcttcatcaac
ctgttctccatgatgctgggctccggcatgccggagctgcagtccttcgacgacatcgcg
tacatcaggaagaccctggcgctggacaagtccgagcaggaggcgctggactacttcatg
aagcagatgaacgacgcccaccatggcggctggaccaccaagatggactggatcttccac
acaatccgccagcacgctatgaactaa

KEGG   Oryzias latipes (Japanese medaka): 101170665
Entry
101170665         CDS       T02443                                 

Gene name
pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101170665 (pik3r3)
   04370 VEGF signaling pathway
    101170665 (pik3r3)
   04068 FoxO signaling pathway
    101170665 (pik3r3)
   04070 Phosphatidylinositol signaling system
    101170665 (pik3r3)
   04150 mTOR signaling pathway
    101170665 (pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101170665 (pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    101170665 (pik3r3)
   04218 Cellular senescence
    101170665 (pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101170665 (pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101170665 (pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101170665 (pik3r3)
   04625 C-type lectin receptor signaling pathway
    101170665 (pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101170665 (pik3r3)
   04914 Progesterone-mediated oocyte maturation
    101170665 (pik3r3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101170665 (pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101170665 (pik3r3)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101170665 (pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_2 SH3_9 SH3_1 DUF4201 CC2-LZ DUF5638
Other DBs
NCBI-GeneID: 101170665
NCBI-ProteinID: XP_011472589
UniProt: A0A3B3HQV4
LinkDB
Position
4
AA seq 719 aa
MGSETFQYRALFEYKREHTNDISLQPGDLLTVAKASLMSAEPPEGGERSPPGWLPGVNER
SKEKGLFPRTFVEFIGVVAKPWPRPGLPAAEGQLGAAASSGAEAELLLAAAPVFAQRLIE
AIEKHGVNGEPLYQRSSSNSGPIALRQVLDSDPISADLDKYDVVSLSDALRDFLQDLQTP
IIPPIVYNELVYTAQENQTVEECGEKLRSILESPNMPLANHQLLVCLSRHWDRVAQQGQA
SPRLLAQAFADVVFKQTPLRTDVNPELHLQIFEALITTGGLTEMQAAPALPPKPAKSQQS
SSVGVGGGSTTTKDGGALQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTL
TLRKGGNNKLIKIYHRDGKYGFSEPLTFNSVVDLISHYRHESLAQYNTKLDVKLMYPVSR
FQQDQLVKEDNIDAVGKKLQEYHNQYQDKSKDYDRLYEDYTKTSQEIQMKRTAIEAFNET
IKIFEEQCHTQERYSKDYIERFHREGNDKEIERIMMNYEKLKSRLGEIHDSKVRLEQDLK
TQAMDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGLKNENTDESSF
VSEEEENLPHYDEKSWFVGNLNRMEAEELLIGKSDGVFLIRESSKKGCYACSVVVDGEVK
HCVIYSTPRGFGFAEPYNLYSSLKDLVLHYQQTSLVQHNDSLNVRLAYPVYTQMPSGRR
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggatcagagactttccagtacagagccctctttgagtacaagcgcgagcacaccaat
gacatcagtctccagccaggtgacctgctcaccgtcgccaaggcctcgctcatgtctgca
gagcccccagagggcggcgagcgaagccccccgggctggttgcctggcgtcaacgagagg
agcaaagagaagggactcttcccaaggacgttcgtggagtttattggagtggtagcaaaa
ccgtggccccggcctggactgccagctgcagagggccagcttggagcggcagcttcttca
ggtgctgaggcggagcttctgttggcagcagctccggtgtttgctcagagacttatcgaa
gccattgagaagcacggtgtaaatggtgagcctctgtatcaacgttcgtcatccaacagt
ggacccatagcgctccggcaggttctggattcagaccccatctcggcagatttggacaag
tacgatgtggtttctctgagtgatgccctgagagatttcctgcaagacctgcaaacccct
attatccctcctatcgtctataatgaactggtctacacagctcaagagaatcaaacagtg
gaggaatgtggggagaaactaagaagtatcctggagtctcccaacatgcccctagccaac
caccagctgctggtctgcctcagcaggcactgggaccgggtcgcccagcagggtcaggcc
agcccccggctgctggcacaagctttcgcggatgttgtcttcaagcaaactcctctcaga
acagatgtgaatccagagcttcacctccagatttttgaggctctcatcacaactggagga
cttacagagatgcaggcggccccagctcttcctccaaagccagcaaagtcccagcagtcc
tcatcagtgggagtggggggaggcagcaccaccaccaaggatggaggagcgttgcaagaa
gccgagtggtactggggggacatttccagggaggaagtgaatgataaactcagagacatg
cctgacgggaccttcctggtgagggatgcttccacgaagatgcaaggcgactacacactc
acactgaggaaaggaggcaacaataagctgatcaagatctaccacagggatgggaagtac
ggtttctcagagccgctgaccttcaactcagtggtggatctcatcagccactacaggcac
gaatctctggcccagtacaacaccaagctggacgtcaagctcatgtatcccgtctcccgc
ttccagcaggatcagctggtaaaggaggacaacattgatgctgttgggaagaaactgcag
gagtaccacaatcagtaccaagacaagagcaaagactacgaccggctctatgaagattac
acaaagacgtcccaggagatccagatgaagaggacggccattgaggcctttaatgagacc
atcaagatctttgaagagcagtgccacacccaggagcgctacagcaaagactacatagag
cgcttccatcgcgaaggcaatgacaaggagatcgagcgcataatgatgaactacgagaag
ctcaagtctcggcttggggagatccacgatagcaaagtgcgactggagcaggacctgaaa
acccaagccatggacaaccgcgagacagacaaaaagatgaacagtctgaagcctgacctc
atacagctgcgcaagatcagggaccaatacctcgtctggctcaatcacaaaggagtacgg
cagaaacgaatcaacgactggcttggcctgaagaacgagaacactgatgagagctccttt
gtgagcgaggaggaagagaacttgcctcactatgatgagaagagctggttcgtggggaat
ctgaaccggatggaggcagaggagctgctcatcggaaagtcagacggagtctttctcatt
cgagaaagcagcaaaaaaggctgctacgcctgctctgttgtcgttgacggggaggtgaag
cactgcgtcatctacagcacgccgcgcggcttcggcttcgctgagccatacaacctgtac
agcagcctgaaagacctggtgctccactaccagcagacctcgctggtgcagcacaacgac
tcgctcaacgtccggctcgcctaccccgtctacacacagatgccctccggacgcagatga

KEGG   Oryzias latipes (Japanese medaka): 101171597
Entry
101171597         CDS       T02443                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101171597 (pik3r1)
   04370 VEGF signaling pathway
    101171597 (pik3r1)
   04068 FoxO signaling pathway
    101171597 (pik3r1)
   04070 Phosphatidylinositol signaling system
    101171597 (pik3r1)
   04150 mTOR signaling pathway
    101171597 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101171597 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    101171597 (pik3r1)
   04218 Cellular senescence
    101171597 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101171597 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101171597 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101171597 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    101171597 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101171597 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    101171597 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101171597 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101171597 (pik3r1)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101171597 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_2 SH3_9 Bap31_Bap29_C Laminin_I PI_PP_I
Other DBs
NCBI-GeneID: 101171597
NCBI-ProteinID: XP_023816922
LinkDB
Position
12
AA seq 728 aa
MSAEAYQYRALYDYKKEREEDIDLHEGDVLLVSKGALVALGYTDGLEQQPNKIGWLPGFN
ETTQEKGDFPGTYVEYIGRKWISPPTPKPRPVRPLPVAPSPVKTDEESDSEQGSCLPDLT
EQFSLPDTAPPMLTRLLEAIEKKGLENPTLYRTFTAGAGLEVRQYFESDPPSADLDQLDL
PVLCDGLRRYLLDLPQPVVHPALQVQMVHTAKEVANPEECAQLLRRVASTPSLPHQYWLA
LHCLLRHFARVCQSGSKNLLSPRTLGEIFSPVFFRQQSVGCEPSLDAYIKIIEVLVTTEW
SESRAAPALPPKPPKPAAVINNGMNNNMALQDAEWYWGEISREEVNEKLRDTADGTFLVR
DASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNP
KLDVKLLYPVSKQQQDQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCQTQERYSKDYIERFRKEGNEKEIQRIMGNYEKLKSRISEI
VDSKRRLEEDLRKQAADYREIDKRMNSIKPDLIQLRKTRDQYLTWLTQKGVRQKKLNEWL
GIKNENTEDQYSMVEDDEDLPHHDERTWKLEKIDRLEAEGLLQGKRDGTFLVRESSKPGC
YACSVMVDGEVKHCVINKTPSGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAY
PVFTHQRR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgagcgccgaagcatatcagtacagagcgctttatgactacaaaaaggagagggaggag
gacatcgacctccacgagggggacgtattgttggtaagcaaaggagctctagtggccctt
gggtacacggatggtctggagcagcagccaaacaagattggctggctgccgggcttcaat
gaaaccactcaggaaaagggggacttcccggggacatatgtcgagtacatcgggaggaag
tggatctccccccccactcccaaaccgaggcccgtccgacctctacctgtggctcccagc
cccgtcaaaaccgacgaagagtccgactcggaacaaggctcctgtttgccggacctgaca
gagcagttttccctcccggacaccgctccacccatgctgaccaggctgctggaagccata
gagaagaaagggctggagaaccccaccctgtaccgaaccttcactgcaggagccggactg
gaggtcaggcagtactttgagtcagatcctccatccgcagacctggatcagctggatctg
ccggtcttgtgcgacggcctgcgccggtacctgctggaccttccccagcccgtcgtccac
ccggcactacaagtccagatggtccacacggccaaagaggtggcgaaccctgaagaatgc
gcccagctgctgcgccgcgtggccagcacccccagcctgccccaccagtactggctggcc
ctgcactgcctgctcaggcactttgctagagtgtgccagagcggctccaagaacctgctg
agccccagaacgctgggggagatcttcagccccgtcttcttcagacagcagtccgtcggc
tgtgaacccagcctggacgcctacatcaagatcattgaggttctggtgaccaccgagtgg
agcgagagtcgagccgctccagctctgcctccgaagcccccgaagcccgcggctgtgatt
aacaacggaatgaacaacaatatggctctgcaggacgcagagtggtactggggggagatc
tccagggaggaggtcaacgagaagctgagggacactgcggacggtacgtttctggtgcga
gacgcctccacgaaaatgcacggcgactacacgctgactctgaggaaaggaggaaacaac
aagcttatcaagatattccaccgggacgggaagtacggcttctccgacccgctgaccttc
agctccgtggtggagctcatcaaccactatcgcaacgaatctctggctcagtacaacccc
aagctggacgtgaagctgctctaccccgtctccaagcaacagcaggaccaggtggtgaag
gaggacaacatcgaggccgtggggaggaagctctgcgaataccaccagcaataccaggag
aagaacaaggaatacgaccgtctgtacgaggagtacaccaggacgtcacaggagatccaa
atgaagcgcacagccatagaagctttcaacgaaaccataaagatattcgaggagcagtgc
caaacgcaggagcggtacagcaaagactacatcgagaggttcaggaaagaaggaaacgag
aaggagatccagaggatcatgggaaactacgagaagttaaagtctagaatcagtgaaatc
gtggacagcaagcgcagactggaggaggacctgaggaagcaggcggccgactacagagag
atcgacaagaggatgaacagcatcaagccggacctcatccagctccgcaagaccagagac
cagtacctcacgtggctgacacagaaaggagtgcggcaaaagaagctgaacgagtggctg
ggaatcaagaacgagaacacagaggatcaatactcgatggtggaggacgacgaagacctc
cctcatcacgacgagcgcacctggaagctggagaagatcgaccggctggaggctgagggc
ctccttcagggaaagagagacggcacattcctggttcgggaaagcagcaagccgggatgc
tacgcatgcagcgtgatggtggacggcgaggtgaagcactgcgtcatcaacaagacgccc
tccggctacggcttcgcggagccctacaacctgtacagctcgctaaaagaactcgtactt
cactaccagcacacgtcgctggtccagcacaatgactctctgaatgtgacgctagcgtac
cccgtcttcacccaccagcggcggtga

DBGET integrated database retrieval system