KEGG   Oryzias latipes (Japanese medaka): 101155199Help
Entry
101155199         CDS       T02443                                 

Gene name
pold1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03420  Nucleotide excision repair
ola03430  Mismatch repair
ola03440  Homologous recombination
Module
ola_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101155199 (pold1)
   03410 Base excision repair
    101155199 (pold1)
   03420 Nucleotide excision repair
    101155199 (pold1)
   03430 Mismatch repair
    101155199 (pold1)
   03440 Homologous recombination
    101155199 (pold1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101155199 (pold1)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101155199 (pold1)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101155199 (pold1)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101155199 (pold1)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101155199 (pold1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101155199 (pold1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2
Motif
Other DBs
NCBI-GeneID: 101155199
NCBI-ProteinID: XP_011476612
UniProt: H2M6Y3
LinkDB All DBs
Position
8
AA seq 1107 aa AA seqDB search
MAFNKRNGGPPFGGLSQAKRGKMSGEWEDSPSQFEEELLMLEEAEMELEEMESQAGHDVI
PVGDLFSADLNPRWPRPHAPTLNPSSETLVFQQIDLDHYLGASVAGMPGQLQEKVPIIRM
FGVTDNGNSVCCHVHGFAPYFYVPAPNGFKSEFLGEFKRELNSAVLKDMRSNKDNISVTV
LAVDITRKENMYGYHGQQSMDFLRITMAMPRLIAPAKRLLEQGFKFGHFPIQGYQSFEAN
IDFEIRFMVDSNVVGCCWIELPKDKWRLREERSTSTGEVDSQTPVKVSLCQYEVDVAWTD
LISHPAEGEWQRIAPLRVLSFDIECAGRKGIFPEPDKDPVIQIASMVQRQGETEPFIRTV
FTLQSCTSIVGSQILCFTQEKQLLQSWAEFLRTVDPDIITGYNIQNFDFPYLINRAAALK
VTYFPYLGRVRNMKSVLKESNFQSKQMGRRENKTINMEGRVQFDLLQVLLRDYKLRSYTL
NAVSFHFLQEQKEDVQHSIISDLQNGNEQTRRRLAVYCLKDAYLPLRLLQKLMCVINYME
MARVTGVPLSYLLSRGQQIKVVSQLLRQAMKQNLVMPVVKTEGGEDYTGATVIEPEKGYY
SVPITTLDFSSLYPSIMMAHNLCYTTLLQKGSVERLQLSSEDFIKTPTGDQFVKSSVRKG
LLPEILENLLSARKRAKAELKKETDPFKKQVLDGRQLALKISANSVYGFTGAQVGKLPCL
EISQSVTGFGRQMIERTKQLVESKYTISNGYQADAKVIYGDTDSVMVKLGVATVKEAMEI
GREAAEWVSSHFTPPIKLEFEKVYYPYLLINKKRYAGLYFSSSADTHDKMDCKGIETVRR
DNCPLVANLINTCLQKILIDRDPQGAVDHAKEVISDLLCNRIDISQLVITKELTRTAQEY
AGKQAHVELAERMRKRDAGSAPNLGDRVPYVIIKAAKGAAAYMKSEDPIYVLENTIPIDT
QYYLEQQLSKPLLRIFEPILGESKAESVLLKGDHTRCKTVLTSKVGGLMAFAQKRSTCIG
CKAVLKTDEAVCDFCKKKESELYQKEIFHLNTLEERFSRLWTQCQRCQGSLHEDVLCTSR
DCPIFYMRKKVQKDLDDQSKLVSRFGW
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaataaaaggaacggcggcccgccttttggtggattatcccaggccaaacgg
ggtaaaatgtccggggagtgggaagacagcccttcccagtttgaagaggaactgttgatg
cttgaagaggcagagatggagttggaggaaatggagagtcaggcaggacatgatgtcatt
ccagtgggtgaccttttttcagccgaccttaaccctcgctggccacggcctcacgccccc
acgctgaacccatcttcagaaactttggtgttccagcagattgatcttgatcactatcta
ggtgcatcggtggcaggaatgcctggccagttgcaagaaaaagtaccaatcattaggatg
tttggcgtgaccgacaatggcaacagtgtgtgctgccatgttcatgggtttgcaccttac
ttctatgttcctgcaccaaatgggttcaaatctgaatttttgggtgagtttaagagagaa
ctgaactctgctgtcctgaaagacatgcgctccaataaagacaacatttcggtcacggtg
ttggctgtggacatcacccgaaaagagaacatgtatggttaccacgggcaacagagtatg
gatttcctgaggatcaccatggcgatgcctcgtctcattgcgcctgcaaagagacttctg
gagcagggctttaaatttggacattttcccatccagggataccaatccttcgaagccaac
atagactttgaaatcaggtttatggtggacagcaatgtggttggatgctgctggattgaa
ctccctaaagacaaatggaggttgagggaagagaggagcacaagcacaggagaagtggac
tctcagactccagtcaaagtgtctctgtgtcagtatgaagtggatgtcgcctggacagat
ttgataagtcacccagcagaaggggaatggcagaggattgcaccacttcgagtcctcagt
tttgacatagaatgtgctggaaggaaagggatctttcctgaaccggataaagatcccgtg
attcagatagcatctatggtgcagcggcagggtgagacggagccgtttattcgcaccgtg
ttcactcttcagtcctgcactagcatcgtcggctcccagatcctgtgcttcactcaggag
aagcagcttcttcagagctgggctgaatttttgcggacggtggacccagatatcataact
ggatacaacatccagaacttcgactttccgtatcttatcaacagggcagcagctctgaag
gtgacttactttccatacttgggccgagtgcgaaacatgaagtcagttctgaaggagtcg
aacttccagagcaaacagatgggccgcagagagaacaagaccatcaacatggaaggccga
gttcagttcgatctgttacaggttctccttagagattacaagttgcgttcctacactcta
aatgctgtgagtttccattttctgcaagaacagaaggaggatgtgcagcactccatcatc
tctgatctgcagaatggaaacgagcaaacgcggcgccgtctggcagtctactgcctgaaa
gacgcgtacctcccgctgcgcctcctgcagaagctgatgtgtgtgatcaactacatggag
atggccagagtgacgggtgtgccgctcagttacctgctctccagagggcagcagatcaaa
gtcgtctctcagctgctgcgacaagccatgaaacagaatctggtcatgcctgtggtgaag
accgaaggaggagaggactacactggagcaactgtcatcgaaccagaaaaaggatactac
agcgtccccatcaccaccctggacttctcctccttgtatccgtccatcatgatggctcat
aacctttgctacaccaccctgctgcagaaaggatccgtagagcgactgcagttgtcatct
gaggatttcatcaagaccccaacaggtgaccaatttgtgaaaagttctgtgaggaaggga
cttcttccggaaatcctggagaacctgctgtctgccagaaagagggccaaagcagagtta
aagaaggaaaccgacccttttaagaagcaggtgctggatggccgacagctggccctaaaa
atcagtgccaactctgtttatggcttcacaggggctcaggtgggcaaactgccctgctta
gaaatctcacagagcgtcaccggatttggaaggcaaatgatcgaacgaactaaacagctc
gtcgagtccaaatacaccatttctaatggttatcaagctgatgccaaggtgatttacgga
gacacagactccgtcatggtcaagctcggagtcgcaacggtcaaggaggccatggaaatc
gggagggaagcggctgagtgggtctcctcccactttacaccccccatcaaactggagttt
gagaaggtttactacccgtacctgctgatcaataagaagcgctacgcaggactctatttc
tcctcaagcgcggacacgcatgacaagatggactgcaaaggcatcgagacggtccgcaga
gacaactgtcctctggtggccaacctaatcaacacctgtctgcagaagatcctgatcgac
agagaccctcaaggtgctgttgatcatgccaaagaagtcatttctgacctgctctgcaat
cgtattgacatcagccagctggtcatcaccaaagagctgacgcgcacggctcaggagtac
gccggcaaacaagcccacgtggagctggcagaaagaatgaggaaaagagacgcaggcagc
gcgccaaacctgggagatcgagtgccgtacgtcatcatcaaagccgcgaaaggcgccgca
gcatacatgaagtcagaggacccgatctacgtgcttgagaacactattcccatcgacaca
cagtactacctggaacagcagctgtccaaaccgctactgagaatatttgagcccatcctc
ggggagagcaaggcagagagcgtcctgctaaagggtgatcacacacgatgcaaaactgtg
ctgacctcaaaggttggaggtctcatggcgtttgcgcagaagagaagcacctgcatcggc
tgcaaggctgtactgaagacggacgaggctgtgtgtgatttctgcaaaaagaaagagtct
gaactgtaccagaaagagatcttccacctgaacacactggaggagcgcttctcccgcctg
tggactcagtgccagcgctgtcagggttccctccatgaggatgtgctctgcaccagccgg
gactgtccaatattctacatgaggaaaaaggtccagaaagatctggacgatcaaagcaag
ctggtgtctcgctttggatggtga

KEGG   Oryzias latipes (Japanese medaka): 101156197Help
Entry
101156197         CDS       T02443                                 

Gene name
pold3
Definition
(RefSeq) DNA polymerase delta subunit 3 isoform X1
  KO
K03504  DNA polymerase delta subunit 3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03420  Nucleotide excision repair
ola03430  Mismatch repair
ola03440  Homologous recombination
Module
ola_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101156197 (pold3)
   03410 Base excision repair
    101156197 (pold3)
   03420 Nucleotide excision repair
    101156197 (pold3)
   03430 Mismatch repair
    101156197 (pold3)
   03440 Homologous recombination
    101156197 (pold3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101156197 (pold3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101156197 (pold3)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101156197 (pold3)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101156197 (pold3)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101156197 (pold3)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101156197 (pold3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101156197 (pold3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC27
Motif
Other DBs
NCBI-GeneID: 101156197
NCBI-ProteinID: XP_004078607
UniProt: H2LAH1
LinkDB All DBs
Position
17
AA seq 441 aa AA seqDB search
MDELYLDNIDEFVNDHNKIVTYKSLSLTLGVHVNTAKQMLYHYLEHKRKESSPQLHATYL
VTGKFVDNGQTCHKVSIVREDQLEDFKSKMSLIVSVHVYSVQKALLKDSGPLYSVDYDAV
KDHLKNCSKYSAIQCSGAVPVSSLERQQALKAHNPPQSEPGNSGTNRETNPASKAHPRPP
KGIMGMFSKKSAVKSQNTSEEVKPEQKDEPAVVDTAKNKPAAKANPMMNFFGSQTAKKSV
KAVKEEADQTSSTSEPPPPPQRKSPQPCEKFDGAAVQTQKDPRSKTKRAEDEDSEEDKMD
KKKRRRIKKPEPDSSDEEVVPDSPQPQETLTRERSPKKETETVQPSNGHSGAKVRKRRRV
LKSRTYLDADGCMVTEKGFESESYSESEEDFQAPKAAQTAPFKAKPNPGSKEDDKKIQKK
APANSNKGGKQASIMGFFQKK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatgagttgtacttggataatattgacgaatttgtgaacgatcacaacaaaatagtt
acctataaatcgttgagtctgacacttggagtccatgtaaacacagcaaagcaaatgctt
tatcattacttggagcacaagaggaaggagagctcacctcagctgcatgcaacctacctg
gtaaccgggaagtttgttgacaacggtcaaacttgtcacaaagtgtcgattgtgagagaa
gatcagttggaagatttcaaatcaaagatgagcctgatagtcagcgttcatgtctacagc
gtacagaaagctctgctgaaagacagcggacccctttactccgtcgactatgacgccgtg
aaagaccatctaaagaactgcagcaagtacagcgccattcagtgttccggcgccgtgccc
gtgtcttccctggagcggcagcaggcgttgaaagcacacaaccctcctcagtctgagcct
ggaaactctgggaccaacagagaaaccaaccccgcttccaaggcccaccccagaccgcca
aaaggcatcatgggaatgttttcaaagaaatctgcagtgaagagtcagaatacaagcgaa
gaagtcaaacctgagcagaaagatgagccagcagtggtggatactgctaaaaacaagcca
gctgcaaaagccaatccaatgatgaacttctttgggagtcaaacagcaaaaaaatcagtc
aaagccgtgaaggaggaagcagatcagacgtcttccacatctgagccgccgccgccgccg
cagcgtaaaagtcctcaaccctgtgaaaagtttgacggtgcagcagtgcagacccaaaaa
gaccccagaagcaaaaccaagagagcggaagacgaagacagtgaagaggacaagatggac
aagaagaagaggcggaggattaagaaaccagaaccagacagcagtgatgaagaagtcgtt
ccggattccccacagccccaagagactctaactagagagagaagtcctaaaaaagaaacg
gaaactgttcagccgtcaaatggtcactctggggcgaaggtgaggaagaggagacgggtc
ctgaagtctcgcacatatctggacgctgatgggtgtatggtcacagaaaaaggctttgag
agtgaatcgtactctgaatccgaggaggatttccaagcccccaaagcggctcagacggcg
ccgtttaaggccaaaccaaacccggggagcaaagaggacgacaagaaaattcagaaaaaa
gctccggccaactccaacaaaggaggaaaacaagcttctattatgggattttttcagaag
aagtga

KEGG   Oryzias latipes (Japanese medaka): 101156744Help
Entry
101156744         CDS       T02443                                 

Gene name
pold2
Definition
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03420  Nucleotide excision repair
ola03430  Mismatch repair
ola03440  Homologous recombination
Module
ola_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101156744 (pold2)
   03410 Base excision repair
    101156744 (pold2)
   03420 Nucleotide excision repair
    101156744 (pold2)
   03430 Mismatch repair
    101156744 (pold2)
   03440 Homologous recombination
    101156744 (pold2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101156744 (pold2)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101156744 (pold2)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101156744 (pold2)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101156744 (pold2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101156744 (pold2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Motif
Other DBs
NCBI-GeneID: 101156744
NCBI-ProteinID: XP_004072565
UniProt: A0A3B3HC50 A0A3P9LQX6
LinkDB All DBs
Position
9
AA seq 471 aa AA seqDB search
MFSDVSAQKNGPSLLCSPASEEQGPTFERISLPYELYSDRYRVGQRSFSRQYAHIYAARL
MQMRPLLAERAQQKWGSNVLIKKLCDLEPGEQCCIVGTLFKRMELQPSILKEISEEHNLL
PQPARAKYISEADELILEDELQRIKLEGKFDKDKCVTGSVVAIYGAEKNDGKFTVEDFCM
ADLPLQTPRPALSSDRFVLLASGLGLGGHNADSMLGLQLLVDMVTGQLGDTGEQSGAAAI
SRVLLAGNLLSQNTQDKDASTKAKYLTKKTQAGSVEAIRVLDELLLQLVASVPVDVMPGQ
YDPTNYTLPQQPLHPCMFPLSSAYNTLQLVSNPFEASIDGVRFLGTSGQNVCDIQRYSSM
DSHLEILEETLQLRHLAPTAPDTLGCYPFYQKDPFILEECPHVYFSGNAPTFESKLIKGP
DGQEVLLVTIPEFSSTQTACLVNLRTLQCEPISFTAFSADKDEENEMNISH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgacgtgagcgcccagaagaatggcccctctcttctctgcagccctgcctct
gaggagcagggccctaccttcgaaaggatatcactaccctacgagttgtactccgatcgt
tacagagttggtcagaggagctttagtcgtcagtatgctcacatttatgcagcaagactc
atgcagatgaggcccctgctggcagagagagctcagcagaagtggggatctaatgttctt
atcaagaaactgtgcgacctagaaccgggggagcagtgttgtattgtggggaccttgttc
aagcgaatggagctgcagccatccatcctgaaggaaatcagtgaagagcacaatctgctg
cctcagcctgcacgagccaaatacatcagtgaagcagatgagctgattttagaggatgaa
ctccagaggatcaagttggagggcaaatttgataaagataagtgtgtcacaggtagtgtc
gttgcaatatatggagctgaaaagaacgatggcaagttcaccgttgaggacttttgcatg
gctgatcttcctttacagacaccaagacctgcgctcagctcagacaggtttgtcctcctg
gcttcaggactcgggttagggggccacaatgctgacagcatgctggggctgcagttgctg
gttgacatggtcaccggtcagcttggagacacaggcgaacaaagcggcgcagcagcaatt
tcccgggttctgttggctggaaacctcctgagccaaaacacccaggataaagacgcatca
acaaaggccaagtacctcacaaagaagacccaggctggcagtgtggaagccatccgtgtt
cttgatgagctgctgcttcagctggtggcttctgttccagtagatgtaatgccgggccag
tatgatccaaccaactacactctcccacagcaacctcttcacccatgtatgttcccctta
tcttctgcatacaacaccctgcagctggtctctaatccatttgaagccagcattgatgga
gtgaggtttctggggacttcaggccaaaatgtctgtgacatccagaggtacagcagcatg
gacagtcacctggagatactggaggagactctgcagctgagacacttggctcccacagct
cctgacactctcggttgttaccctttctatcagaaagatccatttattttggaggaatgt
ccgcatgtttacttcagcggcaatgctccgacctttgagtccaaactcatcaaaggtcct
gatggtcaagaggttcttttggtgacgattccagagttcagcagcactcaaacagcctgt
ctggtcaacttacgcactcttcagtgtgagccaatcagcttcaccgctttttctgctgac
aaagatgaagaaaatgagatgaatatcagccactaa

KEGG   Oryzias latipes (Japanese medaka): 105354361Help
Entry
105354361         CDS       T02443                                 

Gene name
pold4
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03030  DNA replication
ola03410  Base excision repair
ola03420  Nucleotide excision repair
ola03430  Mismatch repair
ola03440  Homologous recombination
Module
ola_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105354361 (pold4)
   03410 Base excision repair
    105354361 (pold4)
   03420 Nucleotide excision repair
    105354361 (pold4)
   03430 Mismatch repair
    105354361 (pold4)
   03440 Homologous recombination
    105354361 (pold4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    105354361 (pold4)
   03400 DNA repair and recombination proteins [BR:ola03400]
    105354361 (pold4)
DNA replication proteins [BR:ola03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    105354361 (pold4)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      105354361 (pold4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     105354361 (pold4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 DUF1296
Motif
Other DBs
NCBI-GeneID: 105354361
NCBI-ProteinID: XP_023809740
LinkDB All DBs
Position
1
AA seq 108 aa AA seqDB search
MTTKRGLITDSFKVVKKKKRERKQEKSPTPPPPRTENVADTVQQEALQKLRDFDLELRFG
PCTGISRLQRWERAELHGLDPPEEIRELLLKAPADPEYSLSLWSEYPL
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaagcggggactcatcactgactccttcaaggtggtgaagaaaaagaagaga
gaaaggaagcaggagaagagccccacgccgcccccccctcggacagaaaatgttgcagac
accgtccagcaggaggcgctgcagaagctcagagacttcgacttggaattgagatttggg
ccgtgcacagggatcagtcgtctgcagaggtgggagagagcagagctgcacggcctggac
ccccccgaggagatcagggagctgctgctgaaagcccccgccgaccccgagtacagcctg
agcctgtggagcgaatatcctttgtga

DBGET integrated database retrieval system