KEGG   Oryzias latipes (Japanese medaka): 101155245Help
Entry
101155245         CDS       T02443                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101155245 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101155245 (sod2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101155245 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101155245
NCBI-ProteinID: XP_004083519
UniProt: H2MDG9
LinkDB All DBs
Position
24
AA seq 226 aa AA seqDB search
MLCKVWQMRSCASILHQTVSWKVGSSRQKHTLPDLTYDYGALEPHICAEIMQLHHSKHHA
TYVNNLNVTEEKYQEALAKGDVTAQVTLQPALKFNGGGHINHTIFWTNLSPNGGGEPQGE
LMEAIKRDFGSFQKMQEKLSAATVAVQGSGWGWLGYDKESGRLRVAACANQDPLQGTTGL
IPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVVNWENVSERLQIAKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcaaagtctggcaaatgcgcagttgtgcatcaatcctgcaccaaactgtttct
tggaaagtcggatcatcaaggcagaaacacacacttcctgacctgacctatgattacggc
gccctggagccccacatctgtgcagagataatgcagctgcaccacagcaaacatcatgct
acatatgtcaacaacctcaatgttacagaggagaagtatcaggaggcacttgcaaaggga
gatgtgactgcacaggttacccttcagcctgctctgaagtttaatggaggaggtcacatt
aaccacactatcttctggacaaacctttctcccaatggtggaggcgagccgcaaggggag
ctgatggaggccatcaaacgagactttggctccttccaaaagatgcaagagaagctctct
gctgctactgtggctgtgcagggctcaggatggggatggctgggctatgacaaagagagt
gggaggttacgcgttgctgcttgtgctaaccaagaccccctgcagggaacaacaggtctc
atccctctcctcggtattgacgtttgggagcatgcttactatcttcagtataaaaatgtg
cgtcctgactatgtaaaggctatttggaatgtagttaactgggaaaatgtgagtgagcgt
cttcagatagccaaaaagtag

DBGET integrated database retrieval system