KEGG   Oryzias latipes (Japanese medaka): 101155285
Entry
101155285         CDS       T02443                                 

Definition
(RefSeq) sestrin-2 isoform X1
  KO
K20394  sestrin 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101155285
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101155285
SSDB
Motif
Pfam: PA26 TetR_C_6 CMD
Other DBs
NCBI-GeneID: 101155285
NCBI-ProteinID: XP_011479500
UniProt: H2M654
LinkDB
Position
11
AA seq 559 aa
MIGSAEPDVNMASLTCLDNGEDNSKKVSGSGVSCRFKSDSESDSGPVAKSFARLCSRDEG
ERASALEELSQKVLVCLGMDRSDSEQLSKQTLLHLLRLSNSCPLQEVRSKATELLRTAKE
EGVEIPRALASGPSSVIPAKEMPIEGPNHDVLIESFLSLGRVDHLTMVMALHPAYLSCFL
RTQQALLELDGPLPHHWRHYISIMAAARHHCSYLVQQHSAGFLETGGEESWLSGLEHAPA
KLRSLQTLNKLLAHRPWLITQQHIEELVCPGAEPRWSLAELIHAVILMAHTHALCSFVWG
CGLNPEPDHAGGYTFQPPSPSHLPRSPAHEDGRQEQADGTVEVEVLMKRMAELQQQEEEE
CSQEEMVSRFERERSESIPTAVVRGAPPDLLLCLVVDPEFRYEDFAPRGEQSPTTMRAQD
YSWEDHGFSLVNRLLPDMSHLLDEKFQVVSNLTYHRMAMHEGVDTYTLRKALWNYIHCLY
GIRYDDYDYGSINVLLERSLKVFVKTVACYPEQTTTRIYCAFWRHFRHSEKVHANLIVME
ARLQAALLYVLRAITHYMR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgatcgggagcgctgagccagacgtgaacatggccagcttgacctgcctggataatggc
gaagacaactccaagaaagtgtccggttctggcgtttcgtgccgcttcaagtccgattcc
gagtcggacagtggaccggtcgcgaagagctttgcgcggctgtgcagcagggacgaagga
gagcgggcatcggctctggaggagctgagccagaaggttctggtgtgtttaggcatggac
cggtccgattcggagcagttgagtaaacaaacgctgctgcatctacttcgactgtccaat
tcgtgtccgctgcaggaggttcgttcgaaggccaccgaactactacgaactgccaaggaa
gaaggagttgaaatacctcgagctttggcctctggtccaagttctgttattcctgcaaaa
gagatgccgatcgaaggaccgaatcacgacgtgctgattgaatccttcctctctctgggt
cgtgtggaccatctcaccatggtcatggctctacatccagcttatctcagctgtttcctg
aggacccagcaggctctgttggagctggatggccccttgccccatcactggagacattac
atttccatcatggctgcagcgcggcaccactgctcatacctggtgcagcagcacagtgcg
ggcttcttggagacgggaggcgaggagagctggctaagtggccttgagcacgctcccgct
aaactgcgcagcctacaaacactcaacaagctgctggcgcacagaccatggctcattacc
cagcagcatatcgaggagttggtgtgtcctggagctgagcctcgctggtccctcgccgag
ctgatccacgccgtcatactgatggcgcacactcacgctctatgttcctttgtgtggggc
tgcggtttgaatcctgaacccgaccacgctgggggctacacgttccaacctccatctccg
agtcaccttccgcgcagccctgctcacgaggacggcaggcaggagcaggcggatggcaca
gtagaggtggaggtgttgatgaagagaatggcggagctgcagcagcaggaggaagaggag
tgctcacaggaggagatggtgtcccggtttgagagggagaggagtgagagcataccgacc
gcggtggtgcgaggagctccgcctgacctgctgttgtgtctggtggtggatcccgagttc
agatatgaggactttgcacccagaggagagcagtctcccaccaccatgagagcccaggac
tactcatgggaggaccacggtttctctctggttaacagacttctgccggacatgagccat
ctcctagacgagaaatttcaggttgtgagcaacttgacgtaccacaggatggccatgcat
gaaggtgtggacacatacactttgaggaaagccctgtggaactacattcactgtctgtat
gggatacgctacgatgactatgactacgggagcataaatgtgttgctggagcgctctctg
aaggtgtttgttaaaaccgtggcgtgttaccctgaacagaccaccacccgcatttactgc
gccttctggagacacttcagacactctgaaaaggtccatgcaaatctaatagtgatggaa
gcccggcttcaagcagctctcctctacgtcctacgagccattacacactacatgagatga

KEGG   Oryzias latipes (Japanese medaka): 101156699
Entry
101156699         CDS       T02443                                 

Gene name
sesn1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101156699 (sesn1)
SSDB
Motif
Pfam: PA26 CMD VDE
Other DBs
NCBI-GeneID: 101156699
NCBI-ProteinID: XP_011489904
UniProt: A0A3B3I4R8
LinkDB
Position
24
AA seq 545 aa
MMEVQDQESLGRWDRLGSRDLSTRLEAMEIISQEVTRKVEAIGPLTSSPPATGTVLSSDL
NDILAHLLMLSKRCPFEDVRERCIQLLQEVQDLGVRIPRPLGNGPSRFIPEKEILQVSKV
DSRTQSIFEDAFAALGRLDNISLVMGFHPQYLESFLRTQHYLLQMDGPLPLHYRHYIGIM
AAARHQCSYLVNLHVNDFLQVGGDAKWLNGLGEAPQKLQQLGELNKILAHRPWLITKEHM
EALLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGITPEIHCDGGHTFRPPSLSQYCV
CDIANGNGHANQHDDQLDDQDMCGEVEVLMERMKQLQECRDDEEASQEEMATRFEREKTE
SMLVVTSEDEECVPSRDISRHFEDPSYGYKDFSRRGEHVPTFRAQDYSWEDHGYSLVNRL
YPDVGQMLDEKFQMAYNLTYNTMATHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQ
LLDRSFKIYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYALRAI
TRYMT
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgatggaggtgcaggaccaggaatccttgggtaggtgggacaggctgggcagccgggac
ctcagcaccagactcgaagcgatggagatcatttcccaggaggtgacaaggaaagtggag
gccatcggacctctgacatcgtcgcccccggcaactgggactgtgctcagcagtgatctg
aatgacatcttggctcatcttcttatgctctccaaacggtgtccttttgaagatgtgaga
gagaggtgcattcagctccttcaggaggtccaggacttgggggtaagaatcccaagaccc
ctaggaaacggaccgagcagattcatccctgaaaaagagattcttcaagtcagtaaagtg
gactccaggacgcagtcgatatttgaggatgcatttgcagcccttggtcgcctggacaac
atctccctcgtgatgggcttccaccctcagtacctggagagcttcctccgaacgcagcac
tacctgctgcagatggacggacctcttcctttgcactacagacactatatcggcatcatg
gcggcggcgagacatcagtgttcctatttggtcaacctacacgtgaatgacttcctccag
gttggcggggacgctaagtggttgaacggtctgggtgaagctccgcaaaagctgcagcag
cttggagaactcaacaaaatcctggctcaccgtccttggcttatcaccaaggaacacatg
gaggctcttctaaaggcggaggagcacagctggtccctggcggagctgatccacgccgtg
gttctgctcacacactaccactccctcgcctccttcaccttcggctgcggcatcacgccg
gagatccactgcgacggtggccacacgttcagaccgccctcgctcagccagtactgcgtg
tgcgacattgcaaacgggaacggccacgccaatcagcacgacgatcagctggacgatcag
gacatgtgtggggaggtggaggtgctgatggagaggatgaagcagctgcaggagtgtcgc
gatgacgaggaggcgagccaggaggagatggcgacccgctttgagagggagaagactgag
agcatgctggtggtcacatcagaggatgaggagtgcgttccatccagagacatctcccgc
cactttgaggaccccagctacggctacaaggacttctcccgccggggggagcatgtgcca
acattcagagcacaggactacagctgggaggaccacggttactcactcgtcaacagactt
tatcccgacgtcgggcagatgctggatgagaagtttcagatggcctacaatctgacatac
aacaccatggcaacgcacaaggatgtggacaccagcatgctgcgtagagccatctggaac
tacatccactgcatgtttggcatcaggtatgacgactatgattacggggagataaaccag
cttttggaccgtagctttaagatctatattaaaaccatggtgtgcagccctgaaaagacc
accaaacgaatgtatgagagtttctggaggcagtttcagcactccgagaaggtccacgtt
aatttgcttcttatggaagcacggatgcaagcagaactgttatacgctctgagagcgatc
acacgctacatgacatga

KEGG   Oryzias latipes (Japanese medaka): 101170524
Entry
101170524         CDS       T02443                                 

Definition
(RefSeq) sestrin-3 isoform X1
  KO
K10141  sestrin 1/3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101170524
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 101170524
NCBI-ProteinID: XP_011478296
UniProt: A0A3B3HNY1 A0A3P9I6P7
LinkDB
Position
10
AA seq 445 aa
MIICTNKMEYRLRSQCQRVQKQGLQVMVNGEKDRVSLLVMKALVSRGSVDAVSQQMATHP
QYLESFLRTQHYILHMDGPLPLPYRHYIAIMAAARHHCDYLVYLHSAQFLRVGGDHLWLQ
SLEAAPPRLRLLDHINKVLAHQPWLTACSHIQTLLKAGEQCWSLAELVQAVVILAHCHSL
CSFVCGCDVNPDFVLFSKSPNDTLPAFSPYDAANGNTNVPQSLAAPSEHRTRRRSLESSC
EMVFLRERIQKSQEERDKREEQFLQTHQQTDTEEEEEMICFADPSRFITDPDFCYQEFSR
REEDRFQVLRIQDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVATLPSLHSPDLKRAVWNY
IHFVLGIRYDDYDYGEVNQLLEPDLKLYIKAVACFPDATKTLMCPLSLTAAKSSERTHIN
LLIMEARLQAELLYALRAITQYMIT
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatcatctgcacgaataaaatggagtatcgcttaagatcgcagtgccagcgagtacag
aagcagggtctgcaggtgatggtgaacggtgagaaggaccgagtgtcgctgctggtcatg
aaggcgctggtcagcagggggagtgtagacgccgtatcccagcagatggccactcacccc
cagtatctggagagcttcctgcgcacacagcactacatcctgcacatggacggccccctg
ccgctaccatatcgccattacatcgccatcatggctgcagctcgacaccactgcgactac
ctggtgtacctgcactcagcccagtttctgagagtgggaggcgaccatctgtggctgcag
agtttggaagcagcgcctcctcgtcttcgtctccttgaccacattaacaaggtgctggcc
caccagccgtggctaaccgcctgctcccatatacagacgttgctgaaggcgggcgagcag
tgctggtcactggcagagctggtgcaggccgtggtaatcctggctcactgtcactccctc
tgcagctttgtgtgtggatgcgatgtgaacccggactttgtcctgttctccaaatctccc
aacgacacgctgccagccttcagcccttacgatgctgccaacggcaacaccaatgtgcct
cagtcgcttgctgccccctctgaacatagaacacggcgacggtccctggaatccagttgt
gagatggtctttcttagagagaggatccagaagtcccaggaggaacgggacaaaagagaa
gagcagtttctgcagacacaccagcaaacagacacggaagaggaggaggagatgatttgc
ttcgcagatccgtcgcgctttatcacagatcctgacttttgctatcaggagttcagccgc
cgagaggaagatcgtttccaagtgttaagaattcaggactattcgtgggaagaccacggc
ttctccttggtcaacagactgtactcggacatcgggcacctgttggacgacagattcaga
agtgtagccaccctgccctcgttgcatagccccgacctgaagagagccgtctggaattat
attcattttgttttaggaatccgctatgatgattatgattatggagaggtgaaccagttg
ctggaaccagatttaaagctgtacatcaaagccgtggcttgtttcccggacgccacaaaa
accctgatgtgtccgctgagtttgaccgccgctaaaagctctgaacggacacacattaat
ttactcatcatggaagcccggctgcaggcagagctgctctacgcactgagagccatcact
cagtacatgattacctaa

DBGET integrated database retrieval system