KEGG   Oryzias latipes (Japanese medaka): 101155408Help
Entry
101155408         CDS       T02443                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101155408 (suv39h1)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101155408 (suv39h1)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101155408 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101155408 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101155408
NCBI-ProteinID: XP_004086400
LinkDB All DBs
Position
7
AA seq 412 aa AA seqDB search
MADNSTGCSVPCKMTYGELEALCRTETLHCKELGVSRANVNEYEVEFLCNYKKTKEEEEF
YLVKWKGFPESDNTWEPKRNLKCSKLIKQFHLDLDLVLKSQKRRAIPKKLDKEVALFLIQ
KAKLRQSLQRWQDHLNDTRNHPGRIFVTNDVDLEGPPKNFTYINNYKVGPGIVLNEMAVG
CDCKNCLEDPVNGCCPGASLHRMAYNDRGQVRIRPGKPIYECNSRCSCGPDCPNRVVQKG
IQFDLCIFKTEDGRGWGVRTLQGIKKNTFVMEYVGEIITTDEAEKRGHLYDRQGSTYLFD
LDYVEDVYTVDAAHQGNISHFVNHSCNPNLQVFNVFIDNIDERLPRIALFSTRSIRAGEE
LTFDYKMQIDPVDTESTKMDSSFSLAGLPGSPKKRVRVECRCGSELCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaattcgacaggatgcagcgtgccttgtaagatgacgtatggcgagctggaa
gccttgtgtcgcactgagaccctgcactgcaaagagctcggagtgagcagagcgaatgtc
aacgagtatgaggtggagtttctctgcaactacaagaagactaaggaggaagaggagttc
tacttggtgaagtggaagggcttccctgagtctgacaacacctgggaacccaagaggaac
ctcaaatgctcaaagctgataaagcagttccacctggacctggacctggtgctcaagagt
caaaagaggcgtgccatacccaaaaagttagataaagaggtcgccttgttcctcattcag
aaagccaaactccgtcagagtctccagcgctggcaggaccatctgaatgacactcgcaac
caccccggtcgcatttttgtcacaaatgatgtggacctagagggccctccaaagaacttc
acctacattaacaactacaaagtcggccctggcattgtgttgaatgagatggctgtaggt
tgtgactgtaaaaactgcctggaagatccagtgaacggctgttgtccaggagcctccctg
caccgcatggcctacaacgatcgcggccaggtccggatcaggccaggaaagcccatttat
gaatgtaactcccggtgcagctgcggacctgactgtcccaacagagtggtccagaagggc
attcagtttgacctgtgcatctttaagaccgaggacggccggggatggggcgtgcgcacg
ctgcagggcatcaagaagaacacctttgttatggagtatgttggagagataattacaaca
gatgaagcagagaagaggggccatttatacgaccgccagggctccacctacctgtttgac
ctcgactatgtagaagatgtgtacacagtggatgctgctcaccaaggaaatatctcccac
tttgtcaaccacagttgtaaccctaacctgcaggtcttcaatgtgttcattgacaacatt
gatgagaggctccccagaatcgctctgttctcaacgcgatctatccgggcaggggaggag
cttaccttcgactacaagatgcaaattgatccagtggacacagagagcaccaaaatggac
tccagtttcagcctggctgggctccccggctcgccaaagaagagggtccgggttgagtgt
cggtgtggctccgaactctgtcggaagtacctcttctga

DBGET integrated database retrieval system