KEGG   Oryzias latipes (Japanese medaka): 101155592
Entry
101155592         CDS       T02443                                 

Gene name
ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101155592 (ccne1)
   04114 Oocyte meiosis
    101155592 (ccne1)
   04115 p53 signaling pathway
    101155592 (ccne1)
   04218 Cellular senescence
    101155592 (ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101155592 (ccne1)
   03036 Chromosome and associated proteins [BR:ola03036]
    101155592 (ccne1)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101155592 (ccne1)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101155592 (ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101155592
NCBI-ProteinID: XP_004067535
UniProt: H2ML55
LinkDB
Position
3
AA seq 416 aa
MRGQREQKEPTSVAPTERSERSRKRKADVAIFLQDPDEDEAEMTKKRQHLDCEVDWSPDS
DRTSPHRWTPERRQQMSAGFLHLNFHNIFVTPVHCAPLPALCWASKDVVWSNMLAKDKSY
CRDVRMLDKHPHLQPRMRAILLDWLMEVSEVYKLHRETYHLAQDYFDRFMATQRNVLKST
LQLIGITCLFIAAKVEEMYPPKVHNFAYITNKACTEDEILSMEIIVMKELNWNLSPQTPI
SWLSVYMQVAYLKETEELLVPRYPQATFTQIAELLDLCMLDVRCLEFSNGVLAASALFHF
SSLELVEQVSALKRVEVEECVRWMVPFAVALREVGGSAMKAFVGIPAEDVHNIQTHAAYL
TWLEKADAYRDADLHRSCAVPSGVLTPPLSSEKSEDWVQADAAALKKRMCAPSRPL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcgaggacagcgggagcagaaggagcccacgagtgtcgcccccacggagaggtcagag
aggagcagaaagaggaaggcagatgtggccattttcctacaggatcctgacgaagacgag
gcagagatgacgaagaagaggcagcatctggactgtgaggtggactggagccccgactcg
gaccggaccagcccccatcggtggacgccggagcgccgccaacagatgagtgccggtttc
ctgcacctcaacttccacaacatattcgtgaccccggtccactgcgcccccctgccggcg
ctgtgctgggccagcaaggacgtggtgtggagcaacatgctggccaaggacaagagctac
tgcagggacgtccgcatgctggacaagcacccccacctgcagcccaggatgagggccatc
ctgctggactggctcatggaggtaagcgaggtctacaagctgcacagagagacgtatcac
ctcgctcaggattacttcgaccgcttcatggccacgcagaggaacgtgctgaagtccacg
ctgcagctcatcggcatcacctgcctcttcatcgccgccaaagtggaggagatgtatcct
ccaaaggtgcacaactttgcttacatcaccaacaaagcctgcacagaagacgagatcctc
agcatggagatcatcgtcatgaaggagctgaactggaacctcagtccacagactcccatc
tcctggctcagcgtttacatgcaggtggcctacctgaaggagaccgaggagctgctggtg
cccagataccctcaggccaccttcacacagattgcagagctgctggacctgtgcatgctg
gacgtgcgctgcctggagttctccaacggcgtcctggccgcctccgctctgttccacttc
tcctcgctggagctggtggagcaggtttcagctctgaagagggtggaggtcgaggagtgc
gtgaggtggatggtgccgtttgcggtggcgctccgggaggtcggcgggtcggcgatgaaa
gcgttcgtgggaatccctgcggaggacgtgcacaacatccagacgcacgccgcctacctg
acgtggctggaaaaggccgacgcctaccgggacgcggacctgcatcgctcctgtgccgtc
ccctccggggtcctgactccgcccctgagcagtgagaagtcggaggactgggttcaggcg
gacgccgcggctctgaagaagaggatgtgcgcgccgtccagaccgctgtga

KEGG   Oryzias latipes (Japanese medaka): 101172438
Entry
101172438         CDS       T02443                                 

Gene name
ccne2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101172438 (ccne2)
   04114 Oocyte meiosis
    101172438 (ccne2)
   04115 p53 signaling pathway
    101172438 (ccne2)
   04218 Cellular senescence
    101172438 (ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101172438 (ccne2)
   03036 Chromosome and associated proteins [BR:ola03036]
    101172438 (ccne2)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101172438 (ccne2)
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101172438 (ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101172438
NCBI-ProteinID: XP_023820318
LinkDB
Position
16
AA seq 393 aa
MSRRSGRITLQARDSNTPETDRPLLKKRKSEPSKKKLQPASKKQNYEIQTCWSEDGASPC
ILIETPHKELEPTDQSRFKQYRFKNLFIKNSPIPRLSWANSEDVWIKMINKELTYIHDKS
YLQRHPKLQPKMRSILLDWLLEVSEVYSLHRQTAYLAQDYFDRYMLTQEDVSKDILQLIG
ITALFIASKIEEIYPPKILEFAFVTDGACSVWDIQQTELLILKALDWNLFPETPISWLKL
YAQVEAQKDENFLEPQFSQDKYIQITQLLDLCMMDIDSLDYSYSVLAAAAFCHFSSFDVV
HRVSGLTWESVSPCYRWMAPFMDTLQSEPTAQLKNFPKVKADDKHNIQTHVAYLDLLRKA
QERQIDSHDFQMSPVATAATLTPPSSTEKPTSV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtggtcgcatcacacttcaagccagagattcaaacacgcctgaaacc
gacagacccctgctgaagaaaaggaagtcagagccttcaaagaagaagctccagcctgcc
tccaagaagcagaactatgaaatacagacctgttggtcagaggatggtgcaagtccctgc
atcctcattgaaactccacacaaagagctggagcccacagaccaatccagattcaaacag
taccgattcaagaacctcttcatcaagaactcccccatccctcgcctcagctgggctaac
tcagaggatgtgtggataaaaatgatcaacaaggagctgacctacattcacgataagagc
tacctgcagcggcatccaaagctgcaacccaagatgaggtccatcctgctggactggctg
ctggaggtgagtgaggtttacagcctccacaggcagaccgcttacttggctcaggactac
tttgaccgctacatgctgactcaagaggatgtcagcaaagatatcctgcagctcatcggc
atcaccgcgctcttcatcgcctcaaagatagaggagatctatcctcccaaaatcctcgag
tttgccttcgtcacagatggagcctgcagcgtgtgggacatccaacaaacagaacttctt
atacttaaggctttggactggaacttgtttccagagacgcccatctcgtggttgaagctg
tacgcccaggtggaggcccagaaagatgagaacttcctggagccacagttcagtcaagac
aagtacatccagatcacacagttattggacttgtgtatgatggacatcgactcgctggac
tacagctacagcgttctcgctgctgccgctttctgccacttctcatcttttgatgttgtt
catagagtctcaggcctgacgtgggagagcgtctccccctgctatcgatggatggccccc
ttcatggacacgcttcaatctgagcccacagcccagctcaaaaatttccctaaggtcaaa
gccgacgacaaacacaacatccagacgcacgtggcttatctggacctactgagaaaagct
caggagcgtcagatcgacagccacgactttcagatgtcgcctgttgctacggcagccacc
ttgactcctcccagcagtacagagaaacccaccagtgtctga

DBGET integrated database retrieval system